DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rho-6 and RBL6

DIOPT Version :9

Sequence 1:NP_788038.1 Gene:rho-6 / 34640 FlyBaseID:FBgn0032415 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_001184975.1 Gene:RBL6 / 837831 AraportID:AT1G12750 Length:307 Species:Arabidopsis thaliana


Alignment Length:249 Identity:57/249 - (22%)
Similarity:103/249 - (41%) Gaps:65/249 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 RTIDVGHVRRKR------LWRVPWFILLMSFVQISLHWIA--------------SECMQKVL--- 97
            |:.|:...|:.|      .|..|..::    ..:|:..:.              .:|:.|:|   
plant     2 RSRDMERGRKHRGDTQWTAWLTPTIVV----ANVSIFIVVMYTNDCPKTTTGANGDCVAKLLRRF 62

  Fly    98 IFKP--------------------EWNV-----EYWRLLTYMLLHSDYWHLSLNICFQCFIGICL 137
            .|:|                    :|..     |.|||:|.|.||:...||.:|:......||.|
plant    63 SFQPLRENPFLGPSSSTLEKLGALDWKKVVQGNEKWRLITAMWLHAGIIHLVMNMFDVIIFGIRL 127

  Fly   138 EVEQGHWRLAVVYMVGGVAGSLANA-WLQPHLHLMGASAGVYAMLGSHVPHLVLNFSQLSHRFAR 201
            |.:.|..|:.::|::.|..||:.:| :||..:. :|||..:..::|:.:..|:.|::....:...
plant   128 EQQFGFIRIGLIYLISGFGGSILSALFLQKSIS-VGASGALLGLMGAMLSELLTNWTIYKSKLCA 191

  Fly   202 IASLLILLLSDVGFTTYHFCHNHNRNPRTSLEAHIGGGVAGILCGFIVYRRLQP 255
            :.|.|.::..::......:..|.         |||||.:.|...|||:.  :||
plant   192 LLSFLFIIAINLAIGLLPWVDNF---------AHIGGLLTGFCLGFILL--MQP 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rho-6NP_788038.1 Rhomboid 106..251 CDD:279958 42/145 (29%)
RBL6NP_001184975.1 Rhomboid 92..232 CDD:279958 42/151 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 84 1.000 Domainoid score I2842
eggNOG 1 0.900 - - E1_COG0705
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1253228at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1037
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.780

Return to query results.
Submit another query.