DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rho-6 and AT5G38510

DIOPT Version :9

Sequence 1:NP_788038.1 Gene:rho-6 / 34640 FlyBaseID:FBgn0032415 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_001078681.1 Gene:AT5G38510 / 833839 AraportID:AT5G38510 Length:434 Species:Arabidopsis thaliana


Alignment Length:165 Identity:42/165 - (25%)
Similarity:74/165 - (44%) Gaps:26/165 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 LIFKPEWNVEYWRLLTYMLLHSDYWHLSLNICFQCFIG--ICLEVEQGHWRLAVVYMVGGVAGSL 159
            ||...||    |||:|.|.|||...|::|:.......|  :|.  :.|.:...::|::|||:|:.
plant   225 LILAGEW----WRLVTPMFLHSGIPHVALSSWALLTFGPKVCR--DYGLFTFCLIYILGGVSGNF 283

  Fly   160 ANAWLQPHLH----LMGASAGVYAMLGSHVPHLVLNFSQL-SHRFARIASLLILLLSDVGFTTYH 219
            .:     .||    .:|.:...:|::|:.:.....|...: |:.:..:....| :::..|....|
plant   284 MS-----FLHTADPTVGGTGPAFALIGAWLVDQNQNKEMIKSNEYEDLFQKAI-IMTGFGLILSH 342

  Fly   220 FCHNHNRNPRTSLEAHIGGGVAGILCGFIVYRRLQ 254
            |      .|.... .::|..:|||:.||.....||
plant   343 F------GPIDDW-TNLGALIAGIVYGFFTCPVLQ 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rho-6NP_788038.1 Rhomboid 106..251 CDD:279958 36/151 (24%)
AT5G38510NP_001078681.1 Rhomboid 225..367 CDD:396315 40/160 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0705
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1253228at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.