DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rho-6 and RBL7

DIOPT Version :9

Sequence 1:NP_788038.1 Gene:rho-6 / 34640 FlyBaseID:FBgn0032415 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_194038.1 Gene:RBL7 / 828406 AraportID:AT4G23070 Length:313 Species:Arabidopsis thaliana


Alignment Length:144 Identity:45/144 - (31%)
Similarity:76/144 - (52%) Gaps:9/144 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 EYWRLLTYMLLHSDYWHLSLNICFQCFIGICLEVEQGHWRLAVVYMVGGVAGSLANAWLQPHLHL 170
            :.|||||.|.||:...||..|:|...:||:.||.:.|..|:..:|:|.|..||:.:.........
plant   103 QVWRLLTCMWLHAGVIHLLANMCCVAYIGVRLEQQFGFVRVGTIYLVSGFCGSILSCLFLEDAIS 167

  Fly   171 MGASAGVYAMLGSHVPHLVLNFSQLSHRFARIASLLILLLSDVGFTTYHFCHNHNRNPRTSLEAH 235
            :|||:.::.:||:.:..|::|::...::...|..||:::..::|..|.         |.....||
plant   168 VGASSALFGLLGAMLSELLINWTTYDNKGVAIVMLLVIVGVNLGLGTL---------PPVDNFAH 223

  Fly   236 IGGGVAGILCGFIV 249
            |||...|.|.||::
plant   224 IGGFFGGFLLGFLL 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rho-6NP_788038.1 Rhomboid 106..251 CDD:279958 45/144 (31%)
RBL7NP_194038.1 Rhomboid 98..224 CDD:396315 37/129 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 84 1.000 Domainoid score I2842
eggNOG 1 0.900 - - E1_COG0705
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1253228at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1037
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
76.780

Return to query results.
Submit another query.