DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rho-6 and RBL4

DIOPT Version :9

Sequence 1:NP_788038.1 Gene:rho-6 / 34640 FlyBaseID:FBgn0032415 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_850698.1 Gene:RBL4 / 824545 AraportID:AT3G53780 Length:394 Species:Arabidopsis thaliana


Alignment Length:275 Identity:67/275 - (24%)
Similarity:119/275 - (43%) Gaps:55/275 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 SNNNCVKDVRLLLLPENSTDSDGNPASVAFSAESHKKFIDDLTRTIDVGHVRRKRLWRVPWFILL 77
            ||||.::.:.|    |:|:...|...|:..|..|:::      |...|...|....|.:|.|::.
plant    21 SNNNNIQPMDL----ESSSSVSGQQRSLTQSRSSYEE------RGRGVKEFRSWFPWLIPCFVVA 75

  Fly    78 MSFVQISLHWI------ASECMQKVL----------------------------IFKPEWNVEYW 108
            ...|.:...::      :.:|....|                            :.|.....|.|
plant    76 NVAVFVITMYVNNCPKKSGDCFADFLGRFSFQNTRENPLLGPSSLTLQTMGGLDVKKVVKGDEGW 140

  Fly   109 RLLTYMLLHSDYWHLSLNICFQCFIGICLEVEQGHWRLAVVYMVGGVAGSLANA-WLQPHLHLMG 172
            |||:...||....||.:|:....||||.:|.|.|..|:.::|::.|..||:.:| :|:.::. :|
plant   141 RLLSCNWLHGGVVHLLMNMLTLLFIGIRMEREFGFIRIGLLYLISGFGGSILSALFLRSNIS-VG 204

  Fly   173 ASAGVYAMLGSHVPHLVLNFSQLSHRFARIASLLILLLSDVGFTTYHFCHNHNRNPRTSLEAHIG 237
            ||..|:.:||..:..:.:|::..|::...|.:|::::..::|....         |.....||||
plant   205 ASGAVFGLLGGMLSEIFINWTIYSNKVVTIVTLVLIVAVNLGLGVL---------PGVDNFAHIG 260

  Fly   238 GGVAGILCGFIVYRR 252
            |...|.|.||::..|
plant   261 GFATGFLLGFVLLIR 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rho-6NP_788038.1 Rhomboid 106..251 CDD:279958 45/145 (31%)
RBL4NP_850698.1 Rhomboid 133..273 CDD:396315 45/149 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 84 1.000 Domainoid score I2842
eggNOG 1 0.900 - - E1_COG0705
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1253228at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1037
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.780

Return to query results.
Submit another query.