DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rho-6 and rhbdf1a

DIOPT Version :9

Sequence 1:NP_788038.1 Gene:rho-6 / 34640 FlyBaseID:FBgn0032415 Length:263 Species:Drosophila melanogaster
Sequence 2:XP_005164392.1 Gene:rhbdf1a / 798402 ZFINID:ZDB-GENE-040704-75 Length:893 Species:Danio rerio


Alignment Length:160 Identity:40/160 - (25%)
Similarity:72/160 - (45%) Gaps:13/160 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 CMQKVL----IFKPEWNVEYWRLLTYMLLHSDYWHLSLNICFQCFIGICLEVEQGHWRLAVVYMV 152
            ||..|.    ...||...:::||...:.||:...|..:::|||..|...||...|..|::::|::
Zfish   672 CMDDVCGLLPFLNPEVPDQFYRLWLSLFLHAGILHCLVSVCFQMTILRDLEKLAGWLRISIIYIL 736

  Fly   153 GGVAGSLANAWLQPHLHLMGASAGVYAMLGSHVPHLVLNFSQLSHRFARIASLLILLLSDVGFTT 217
            .|:.|:||:|...|:...:|.:...:.:|......|:.::..|:..:.....||.::|....|..
Zfish   737 SGITGNLASAIFLPYRAEVGPAGSQFGILACLFVELIQSWQILAQPWRAFTKLLCVVLFLFAFGL 801

  Fly   218 YHFCHNHNRNPRTSLEAHIGGGVAGILCGF 247
            ..:..|.         |||.|.::|....|
Zfish   802 LPWIDNF---------AHISGFISGFFLSF 822

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rho-6NP_788038.1 Rhomboid 106..251 CDD:279958 35/142 (25%)
rhbdf1aXP_005164392.1 Rhomboid_SP 130..347 CDD:289371
Rhomboid 685..826 CDD:279958 37/147 (25%)
DUF805 <792..864 CDD:294752 9/40 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0705
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1253228at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.