DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rho-6 and parl

DIOPT Version :9

Sequence 1:NP_788038.1 Gene:rho-6 / 34640 FlyBaseID:FBgn0032415 Length:263 Species:Drosophila melanogaster
Sequence 2:XP_021322181.1 Gene:parl / 792889 -ID:- Length:361 Species:Danio rerio


Alignment Length:191 Identity:44/191 - (23%)
Similarity:66/191 - (34%) Gaps:34/191 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 WRVPWFILLMSFVQISLHWIASECMQKVLIFKPEWNVEYWRLLTYMLLHSDYWHLSLNICFQCFI 133
            ||||      |...:.:.:..|....|.|.         |.:|.....|...:|||.|:......
Zfish   164 WRVP------SLQHLMVKYFTSNPSSKALC---------WPMLLSTFSHYSLFHLSANMYVLWSF 213

  Fly   134 GICLEVEQGHWRLAVVYMVGGVAGSL-------ANAWLQPHLHLMGASAGVYAMLGSHVPH--LV 189
            ...:....|..:...:|:..||..:.       |...|.|.|...||...|.|.:.:.:|.  |.
Zfish   214 SSSIINMMGKEQFMALYLSTGVISTFVSYVSKTAMGRLGPSLGASGAIMAVLAAVCTKMPEAKLA 278

  Fly   190 LNFSQLSHRFARIASLLILLLSDVGFTTYHFCHNHNRNPRTSLEAHIGGGVAGILCGFIVY 250
            :.|..:....|..|...|:.|...|........:|        .||:||.:.||  .:|:|
Zfish   279 IIFLPMYTFTAGNALKAIVALDTTGLILGWRFFDH--------AAHLGGALFGI--WYIIY 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rho-6NP_788038.1 Rhomboid 106..251 CDD:279958 36/154 (23%)
parlXP_021322181.1 Rhomboid 188..335 CDD:307698 36/152 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0705
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.