DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rho-6 and rhbdl2

DIOPT Version :9

Sequence 1:NP_788038.1 Gene:rho-6 / 34640 FlyBaseID:FBgn0032415 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_957498.1 Gene:rhbdl2 / 792002 ZFINID:ZDB-GENE-040426-732 Length:294 Species:Danio rerio


Alignment Length:247 Identity:70/247 - (28%)
Similarity:120/247 - (48%) Gaps:43/247 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 KDVRLLLLPENSTDSDGNPASVAFSAESHKKFIDDLTRTIDVGHVRRKRLWRVPWFILLMSFVQI 83
            |:|...:|||                |.|:.:::            |......|.||:|:|..::
Zfish    37 KNVSKWMLPE----------------ELHETYLE------------RANCCPPPIFIILISLAEL 73

  Fly    84 SL-----------HWI--ASECMQKVLIFKPEWNVEYWRLLTYMLLHSDYWHLSLNICFQCFIGI 135
            ::           .||  .:......|.::||...|.||.::||.:|:...|:..|:..|..:||
Zfish    74 AVFIYYAVWKPQKQWITLGTGIWDSPLTYRPEQRKEAWRFVSYMFVHAGVEHIMGNLLMQLLLGI 138

  Fly   136 CLEVEQGHWRLAVVYMVGGVAGSLANAWLQPHLHLMGASAGVYAMLGSHVPHLVLNFSQLSHRFA 200
            .||:....:.:.:|||.|.:|||||::...|...|:|||.||||::|.:..:.::||.::.....
Zfish   139 PLELVHKGFEVGMVYMCGVLAGSLASSIFDPFSALVGASGGVYALMGGYFMNAIVNFREMRVLLG 203

  Fly   201 --RIASLLILLLSDVGFTTYHFCHNHNRNPRTSLEAHIGGGVAGILCGFIVY 250
              ||..:::::.:||||..|.....|....:.|..||||||:||:..|::.:
Zfish   204 VFRILVIVLIVGTDVGFALYRRFIVHEAGLKVSFVAHIGGGIAGMTIGYVFF 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rho-6NP_788038.1 Rhomboid 106..251 CDD:279958 52/147 (35%)
rhbdl2NP_957498.1 Rhomboid 104..255 CDD:279958 54/150 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0705
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1253228at2759
OrthoFinder 1 1.000 - - FOG0000995
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45840
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.