DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rho-6 and rhbdf1b

DIOPT Version :9

Sequence 1:NP_788038.1 Gene:rho-6 / 34640 FlyBaseID:FBgn0032415 Length:263 Species:Drosophila melanogaster
Sequence 2:XP_021328201.1 Gene:rhbdf1b / 563403 ZFINID:ZDB-GENE-130531-6 Length:894 Species:Danio rerio


Alignment Length:284 Identity:65/284 - (22%)
Similarity:112/284 - (39%) Gaps:44/284 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SAQVESNGASESNNNCVKDVRLLLLPENST------DSDGNPASVAFSAESHKKF--IDDLT--R 56
            ||.|..:...:..:.|.:|.|:.|.|.:.:      |....|....:|..:|...  ||.:.  |
Zfish   572 SAPVLGDKVRQYGSVCHQDPRICLEPASVSPHVWPDDISKWPICTRYSTGNHTNLPHIDCVITGR 636

  Fly    57 TIDVGHVRRKRLWRVPWFILLMSFVQISLHWIAS-----ECMQKVL----IFKPEWNVEYWRLLT 112
            ...:|...|..:....:    ..|::...|..|:     .||..|.    ...||...:::||..
Zfish   637 PCCIGTKGRCEITSREY----CDFMKGYFHEEATLCSQVHCMDDVCGLLPFLNPEIPDQFYRLWL 697

  Fly   113 YMLLHSDYWHLSLNICFQCFIGICLEVEQGHWRLAVVYMVGGVAGSLANAWLQPHLHLMGASAGV 177
            .:.||:...|..:::|||..|...||...|..|::::|::.|:.|:||:|...|:...:|.:...
Zfish   698 SLFLHAGILHCLVSVCFQMTILRDLEKLAGWLRISIIYILSGITGNLASAIFLPYRAEVGPAGSQ 762

  Fly   178 YAMLGSHVPHLVLNFSQLSHRFARIASLLILLLSDVGFTTYHFCHNHNRNPRTSLEAHIGGGVAG 242
            :.:|......|..::..|:..:.....|..::|....|....:..|.         |||.|.|:|
Zfish   763 FGILACLFVELFQSWQILARPWRAFTKLSCVVLFLFAFGLLPWIDNF---------AHICGFVSG 818

  Fly   243 ILCGFI-----------VYR-RLQ 254
            ....|.           :|| |||
Zfish   819 FFLSFAFLPYISFGRMDMYRKRLQ 842

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rho-6NP_788038.1 Rhomboid 106..251 CDD:279958 35/155 (23%)
rhbdf1bXP_021328201.1 Rhomboid_SP 130..348 CDD:315299
Rhomboid 686..829 CDD:307698 37/151 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1253228at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.