DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rho-6 and ru

DIOPT Version :9

Sequence 1:NP_788038.1 Gene:rho-6 / 34640 FlyBaseID:FBgn0032415 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_524790.1 Gene:ru / 44856 FlyBaseID:FBgn0003295 Length:341 Species:Drosophila melanogaster


Alignment Length:208 Identity:66/208 - (31%)
Similarity:116/208 - (55%) Gaps:13/208 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 DVGHVRRKR--------LWRVPWFILLMSFVQISLH-WIASECMQ-KVLIFKPEWNVEYWRLLTY 113
            |.|:.|.|.        .|..|:||:|.:.:::.:. |:.::..: .:|:::|:..::.||.|:|
  Fly    77 DWGNHRAKHHEGSAAPFKWIPPFFIILATLLEVLVFLWVGADPPEDSLLVYRPDQRLQLWRFLSY 141

  Fly   114 MLLHSDYWHLSLNICFQCFIGICLEVEQGHWRLAVVYMVGGVAGSLANAWLQPHLHLMGASAGVY 178
            .|||:.:.||..|:..|...|:.||:..|..|..|:||.|.:||||..:.:...:.|:|||.|||
  Fly   142 ALLHASWLHLGYNVLTQLLFGVPLELVHGSLRTGVIYMAGVLAGSLGTSVVDSEVFLVGASGGVY 206

  Fly   179 AMLGSHVPHLVLNFSQLSHRFARIASLLILLLSDVGFTTYH---FCHNHNRNPRTSLEAHIGGGV 240
            |:|.:.:..|:|||.|:.|...::.::::.:..|:|:..|.   ..|.....|..|..||:.|.:
  Fly   207 ALLAAQLASLLLNFGQMRHGVIQLMAVILFVFCDLGYALYSRELAMHQLQTRPSVSYIAHMTGAL 271

  Fly   241 AGILCGFIVYRRL 253
            |||..|.::.|:|
  Fly   272 AGISVGLLLLRQL 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rho-6NP_788038.1 Rhomboid 106..251 CDD:279958 52/147 (35%)
ruNP_524790.1 Rhomboid 129..282 CDD:279958 53/152 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457250
Domainoid 1 1.000 84 1.000 Domainoid score I2842
eggNOG 1 0.900 - - E1_COG0705
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 45 1.000 Inparanoid score I2672
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D120647at6656
OrthoFinder 1 1.000 - - FOG0000995
OrthoInspector 1 1.000 - - mtm1037
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45840
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
98.900

Return to query results.
Submit another query.