DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rho-6 and stet

DIOPT Version :9

Sequence 1:NP_788038.1 Gene:rho-6 / 34640 FlyBaseID:FBgn0032415 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_788450.1 Gene:stet / 38169 FlyBaseID:FBgn0020248 Length:485 Species:Drosophila melanogaster


Alignment Length:213 Identity:62/213 - (29%)
Similarity:105/213 - (49%) Gaps:33/213 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 PWFILLMSFVQISLHW--------------IASECMQKVLIFKPEWNVEYWRLLTYMLLHSDYWH 122
            |:||:|::.|::....              |.|:.|   .|::|:...|.||.|.||:||:.:.|
  Fly   222 PFFIILVTLVELGFFVYHSVVTGEAAPRGPIPSDSM---FIYRPDKRHEIWRFLFYMVLHAGWLH 283

  Fly   123 LSLNICFQCFIGICLEVEQGHWRLAVVYMVGGVAGSLANAWLQPHLHLMGASAGVYAMLGSHVPH 187
            |..|:..|...|:.||:..|..|:|.:|..|.:||||..:...|.:.|:|||.||||:|.:|:.:
  Fly   284 LGFNVAVQLVFGLPLEMVHGSTRIACIYFSGVLAGSLGTSIFDPDVFLVGASGGVYALLAAHLAN 348

  Fly   188 LVLNFSQLSHRFARIASLLILLLSDVGFTTYHFCHNHNRNPRTSLE----------------AHI 236
            ::||:.|:.:...::..:|:.:..|.||..|...........:|.|                ||:
  Fly   349 VLLNYHQMRYGVIKLLHILVFVSFDFGFAIYARYAGDELQLGSSSEFLAIDQAETAGAVSYVAHL 413

  Fly   237 GGGVAGILCGFIVYRRLQ 254
            .|.:||:..|.:|.:..:
  Fly   414 AGAIAGLTIGLLVLKSFE 431

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rho-6NP_788038.1 Rhomboid 106..251 CDD:279958 52/160 (33%)
stetNP_788450.1 EFh <75..115 CDD:298682
EF-hand_7 91..156 CDD:290234
Rhomboid 262..428 CDD:279958 53/165 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457251
Domainoid 1 1.000 84 1.000 Domainoid score I2842
eggNOG 1 0.900 - - E1_COG0705
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D120647at6656
OrthoFinder 1 1.000 - - FOG0000995
OrthoInspector 1 1.000 - - mtm1037
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45840
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.850

Return to query results.
Submit another query.