DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rho-6 and rho

DIOPT Version :9

Sequence 1:NP_788038.1 Gene:rho-6 / 34640 FlyBaseID:FBgn0032415 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_001261255.1 Gene:rho / 38168 FlyBaseID:FBgn0004635 Length:355 Species:Drosophila melanogaster


Alignment Length:217 Identity:72/217 - (33%)
Similarity:121/217 - (55%) Gaps:22/217 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 LTRTIDVG---HVRRKRLWRVPWFILLMSFVQISLHWIASECM-------------QKVLIFKPE 102
            |..:.|:|   :|.|:. |  |||||::|.::|::.......|             ..||:::|:
  Fly    84 LPESEDIGLLKYVHRQH-W--PWFILVISIIEIAIFAYDRYTMPAQNFGLPVPIPSDSVLVYRPD 145

  Fly   103 WNVEYWRLLTYMLLHSDYWHLSLNICFQCFIGICLEVEQGHWRLAVVYMVGGVAGSLANAWLQPH 167
            ..::.||..:||.||::::||..||..|.|.||.|||..|..|:.|:||.|..||||..:.:...
  Fly   146 RRLQVWRFFSYMFLHANWFHLGFNIVIQLFFGIPLEVMHGTARIGVIYMAGVFAGSLGTSVVDSE 210

  Fly   168 LHLMGASAGVYAMLGSHVPHLVLNFSQLSHRFARIASLLILLLSDVG---FTTYHFCHNHNRNPR 229
            :.|:|||.||||:|.:|:.::.||::.:.....::.|::|.:..|:|   :|.|.......:.|:
  Fly   211 VFLVGASGGVYALLAAHLANITLNYAHMKSASTQLGSVVIFVSCDLGYALYTQYFDGSAFAKGPQ 275

  Fly   230 TSLEAHIGGGVAGILCGFIVYR 251
            .|..||:.|.:||:..||:|.:
  Fly   276 VSYIAHLTGALAGLTIGFLVLK 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rho-6NP_788038.1 Rhomboid 106..251 CDD:279958 55/147 (37%)
rhoNP_001261255.1 Rhomboid 144..297 CDD:279958 56/152 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457252
Domainoid 1 1.000 84 1.000 Domainoid score I2842
eggNOG 1 0.900 - - E1_COG0705
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 45 1.000 Inparanoid score I2672
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D120647at6656
OrthoFinder 1 1.000 - - FOG0000995
OrthoInspector 1 1.000 - - mtm1037
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45840
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
98.900

Return to query results.
Submit another query.