Sequence 1: | NP_788038.1 | Gene: | rho-6 / 34640 | FlyBaseID: | FBgn0032415 | Length: | 263 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001005767.1 | Gene: | Parl / 381038 | MGIID: | 1277152 | Length: | 377 | Species: | Mus musculus |
Alignment Length: | 196 | Identity: | 47/196 - (23%) |
---|---|---|---|
Similarity: | 69/196 - (35%) | Gaps: | 42/196 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 68 LWRVPWFILLMSFVQISLHWIASECMQKVLIFKPEWNVEYWRLLTYMLLHSDYWHLSLNI----C 128
Fly 129 FQCFIGICLEVEQGHWRLAVVYMVGGVAGS-------LANAWLQPHLHLMGASAGVYAMLGSHVP 186
Fly 187 --HLVLNFSQLSHRFARIASLLILLLSDVGFTTYHFCHNHNRNPRTSLEAHIGGGVAGILCGFIV 249
Fly 250 Y 250 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
rho-6 | NP_788038.1 | Rhomboid | 106..251 | CDD:279958 | 36/158 (23%) |
Parl | NP_001005767.1 | Rhomboid | 207..348 | CDD:279958 | 36/154 (23%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0705 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |