DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rho-6 and Parl

DIOPT Version :9

Sequence 1:NP_788038.1 Gene:rho-6 / 34640 FlyBaseID:FBgn0032415 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_001005767.1 Gene:Parl / 381038 MGIID:1277152 Length:377 Species:Mus musculus


Alignment Length:196 Identity:47/196 - (23%)
Similarity:69/196 - (35%) Gaps:42/196 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 LWRVPWFILLMSFVQISLHWIASECMQKVLIFKPEWNVEYWRLLTYMLLHSDYWHLSLNI----C 128
            |||||      |..:..:.:..|....|||. .|        :|.....|...:|::.|:    .
Mouse   180 LWRVP------SLQRTMIRYFTSNPASKVLC-SP--------MLLSTFSHFSLFHMAANMYVLWS 229

  Fly   129 FQCFIGICLEVEQGHWRLAVVYMVGGVAGS-------LANAWLQPHLHLMGASAGVYAMLGSHVP 186
            |...|...|..||    ...||:..||..:       :|.....|.|...||...|.|.:.:.:|
Mouse   230 FSSSIVNILGQEQ----FVAVYLSAGVISNFVSYVCKVATGRYGPSLGASGAIMTVLAAVCTKIP 290

  Fly   187 --HLVLNFSQLSHRFARIASLLILLLSDVGFTTYHFCHNHNRNPRTSLEAHIGGGVAGILCGFIV 249
              .|.:.|..:....|..|...|:.:...|........:|        .||:||.:.||  .:|.
Mouse   291 EGRLAIIFLPVFTFTAGNALKAIIAMDTAGMILGWKFFDH--------AAHLGGALFGI--WYIT 345

  Fly   250 Y 250
            |
Mouse   346 Y 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rho-6NP_788038.1 Rhomboid 106..251 CDD:279958 36/158 (23%)
ParlNP_001005767.1 Rhomboid 207..348 CDD:279958 36/154 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0705
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.