DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rho-6 and rho-7

DIOPT Version :9

Sequence 1:NP_788038.1 Gene:rho-6 / 34640 FlyBaseID:FBgn0032415 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_001286324.1 Gene:rho-7 / 36281 FlyBaseID:FBgn0033672 Length:351 Species:Drosophila melanogaster


Alignment Length:187 Identity:39/187 - (20%)
Similarity:62/187 - (33%) Gaps:36/187 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 LWRVPWFILLMSFVQISLHWIASECMQKVLIFKPEWNVEYWRLLTYMLLHSDYWHLSLNICFQCF 132
            :||||      :.....:.:..|....||:.         |.:......|....||..|:.....
  Fly   161 MWRVP------ALKSTMITYFTSNPAAKVVC---------WPMFLSTFSHYSAMHLFANMYVMHS 210

  Fly   133 IGICLEVEQGHWRLAVVYMVGGVAGSLANAWLQPHLHLMGASAGVYAMLGSHVPHLVLNF--SQL 195
            ......|..|..:...||:..||..||.:...:......|.|.|....:.:.:.::...:  :||
  Fly   211 FANAAAVSLGKEQFLAVYLSAGVFSSLMSVLYKAATSQAGMSLGASGAIMTLLAYVCTQYPDTQL 275

  Fly   196 SHRF---------ARIASLLILLLSDVGFTTYHFCHNHNRNPRTSLEAHIGGGVAGI 243
            |..|         |.|..|:.:..:.|......|.|          .||:||.:.||
  Fly   276 SILFLPALTFSAGAGIKVLMGIDFAGVVMGWKFFDH----------AAHLGGAMFGI 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rho-6NP_788038.1 Rhomboid 106..251 CDD:279958 32/149 (21%)
rho-7NP_001286324.1 Rhomboid 186..327 CDD:396315 32/147 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444960
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0705
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.