DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rho-6 and rho-4

DIOPT Version :9

Sequence 1:NP_788038.1 Gene:rho-6 / 34640 FlyBaseID:FBgn0032415 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_525084.1 Gene:rho-4 / 32109 FlyBaseID:FBgn0030318 Length:417 Species:Drosophila melanogaster


Alignment Length:266 Identity:71/266 - (26%)
Similarity:128/266 - (48%) Gaps:38/266 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 LLPENSTDSDGNPASVAFSAES--HKKFIDD-LTRTI---------------DVGHVRRKRLWRV 71
            :|..:..|:||:.....|.|.|  ||..:.: |||..               |..:.::..:...
  Fly   114 ILKRSDQDNDGHLDFEEFYAMSLRHKWMVRNMLTRYCRYVVPPPKPLEGDEPDGAYEKQMSICPP 178

  Fly    72 PWFILLMSFVQISLHWI------------------ASECMQKVLIFKPEWNVEYWRLLTYMLLHS 118
            |..::|.|.::|.:..:                  .|.....:.|:.|....|.||.::||.:|.
  Fly   179 PLTMVLFSIIEIIMFLVDVIHFQDDPNYQDRIGESTSGPAATLFIYNPYKRYEGWRFVSYMFVHV 243

  Fly   119 DYWHLSLNICFQCFIGICLEVEQGHWRLAVVYMVGGVAGSLANAWLQPHLHLMGASAGVYAMLGS 183
            ...||.:|:..|.|:||.||:....||:.:||:.|.:|||:..:...|.:.|.|||.||||::.:
  Fly   244 GIMHLMMNLIIQIFLGIALELVHHWWRVGLVYLAGVLAGSMGTSLTSPRIFLAGASGGVYALITA 308

  Fly   184 HVPHLVLNFSQLSHRFARIASLLILLLSDVGFTTYHFCHNHNRNPRTSLEAHIGGGVAGILCGFI 248
            |:..:::|:|::.:...::.:.|:...:|:|.:.|.  |..:::.:....||:.|.|||:|.|..
  Fly   309 HIATIIMNYSEMEYAIVQLLAFLVFCFTDLGTSVYR--HLTDQHDQIGYVAHLSGAVAGLLVGIG 371

  Fly   249 VYRRLQ 254
            |.|.|:
  Fly   372 VLRNLE 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rho-6NP_788038.1 Rhomboid 106..251 CDD:279958 49/144 (34%)
rho-4NP_525084.1 EFh_HEF <57..197 CDD:355006 17/82 (21%)
EFh 73..134 CDD:238008 5/19 (26%)
Rhomboid 226..374 CDD:396315 50/149 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 84 1.000 Domainoid score I2842
eggNOG 1 0.900 - - E1_COG0705
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D120647at6656
OrthoFinder 1 1.000 - - FOG0000995
OrthoInspector 1 1.000 - - mtm1037
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45840
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.920

Return to query results.
Submit another query.