DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rho-6 and Rhbdf2

DIOPT Version :9

Sequence 1:NP_788038.1 Gene:rho-6 / 34640 FlyBaseID:FBgn0032415 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_001100537.2 Gene:Rhbdf2 / 303690 RGDID:1309699 Length:825 Species:Rattus norvegicus


Alignment Length:162 Identity:37/162 - (22%)
Similarity:72/162 - (44%) Gaps:17/162 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 CMQKVL----IFKPEWNVEYWRLLTYMLLHSDYWHLSLNICFQCFIGICLEVEQGHWRLAVVYMV 152
            |:.:|.    ...||...:::|:...:.||:...|..:::.||..|...||...|..|:::::::
  Rat   604 CLDEVCGLLPFLNPEIPDQFYRIWLSLFLHAGIVHCLVSVVFQMTILRDLEKLAGWHRISIIFIL 668

  Fly   153 GGVAGSLANAWLQPHLHLMGASAGVYAMLGSHVPHLVLNFSQLSHRFARIASL--LILLLSDVGF 215
            .|:.|:||:|...|:...:|.:...:.:|......|..::..|...:....:|  ::|.|...|.
  Rat   669 SGITGNLASAIFLPYRAEVGPAGSQFGLLACLFVELFQSWQLLERPWKAFFNLSAIVLFLFICGL 733

  Fly   216 TTYHFCHNHNRNPRTSLEAHIGGGVAGILCGF 247
            .           |.....|||.|.::|:|..|
  Rat   734 L-----------PWIDNIAHIFGFLSGMLLAF 754

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rho-6NP_788038.1 Rhomboid 106..251 CDD:279958 33/144 (23%)
Rhbdf2NP_001100537.2 Rhomboid_SP 98..302 CDD:403706
Rhomboid 617..758 CDD:396315 35/149 (23%)
MFS 718..>808 CDD:421695 12/48 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0705
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1253228at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.