DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rho-6 and Rhbdl2

DIOPT Version :9

Sequence 1:NP_788038.1 Gene:rho-6 / 34640 FlyBaseID:FBgn0032415 Length:263 Species:Drosophila melanogaster
Sequence 2:XP_038965543.1 Gene:Rhbdl2 / 298512 RGDID:1308295 Length:302 Species:Rattus norvegicus


Alignment Length:209 Identity:71/209 - (33%)
Similarity:115/209 - (55%) Gaps:22/209 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 VRRKRLWRV-----PWFILLMSFVQISL-----------HWIASE--CMQKVLIFKPEWNVEYWR 109
            |||..|.|.     |.||:|:|..::::           .||..:  .::..|.::||...|.||
  Rat    57 VRRTYLERANCLPPPLFIVLISLAELAVFIYYAVWKPQKQWITLDTGILESPLTYRPEKREEAWR 121

  Fly   110 LLTYMLLHSDYWHLSLNICFQCFIGICLEVEQGHWRLAVVYMVGGVAGSLANAWLQPHLHLMGAS 174
            .::|||:|:...|:..|:..|..:||.||:.....|:.:||:.|.:|||||::...|...|:|||
  Rat   122 FISYMLVHAGVQHIVGNLFMQLVLGIPLEMVHKGLRVGLVYLAGVLAGSLASSIFDPLKSLVGAS 186

  Fly   175 AGVYAMLGSHVPHLVLNFSQLSHRFARIASLLILLL--SDVGFTTY-HFCHNHNRNPRTSLEAHI 236
            .||||::|.:..::::||.::......:..|:|:|:  ||:||..| .|....|.:| .|..|||
  Rat   187 GGVYALMGGYFMNVIVNFREMIPALGIVRLLVIILIVASDMGFALYRRFFVPANGSP-VSFAAHI 250

  Fly   237 GGGVAGILCGFIVY 250
            .||.||:..|:.|:
  Rat   251 AGGFAGMSVGYTVF 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rho-6NP_788038.1 Rhomboid 106..251 CDD:279958 56/148 (38%)
Rhbdl2XP_038965543.1 Rhomboid 113..265 CDD:396315 58/153 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0705
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1253228at2759
OrthoFinder 1 1.000 - - FOG0000995
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.