DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rho-6 and Rhbdl3

DIOPT Version :9

Sequence 1:NP_788038.1 Gene:rho-6 / 34640 FlyBaseID:FBgn0032415 Length:263 Species:Drosophila melanogaster
Sequence 2:XP_006533389.1 Gene:Rhbdl3 / 246104 MGIID:2179276 Length:433 Species:Mus musculus


Alignment Length:129 Identity:32/129 - (24%)
Similarity:58/129 - (44%) Gaps:34/129 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 DDLTRTIDVGHVRRKRLWRV--------PWFILLMSFVQISL----------------HWIASEC 92
            :.|.|.||       |.|..        |||::.::.::::|                |   ...
Mouse   142 ETLPREID-------RKWYYDSYTCCPPPWFMITITLLEVALFLYNGVLLDQFVLQVTH---PRY 196

  Fly    93 MQKVLIFKPEWNVEYWRLLTYMLLHSDYWHLSLNICFQCFIGICLEVEQGHWRLAVVYMVGGVA 156
            ::..|::.|:...:.||.:||:.:|:....|.||:..|..:|:.||:..|..|:.:||:.|.||
Mouse   197 LKNSLVYHPQLRAQAWRYVTYIFMHAGVEQLGLNVALQLLVGVPLEMVHGATRIGLVYVAGVVA 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rho-6NP_788038.1 Rhomboid 106..251 CDD:279958 19/51 (37%)
Rhbdl3XP_006533389.1 EF-hand_7 36..100 CDD:372618
Rhomboid 207..>260 CDD:389796 17/52 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167834623
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0705
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1253228at2759
OrthoFinder 1 1.000 - - FOG0000995
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45840
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.810

Return to query results.
Submit another query.