DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rho-6 and Rhbdl2

DIOPT Version :9

Sequence 1:NP_788038.1 Gene:rho-6 / 34640 FlyBaseID:FBgn0032415 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_898986.2 Gene:Rhbdl2 / 230726 MGIID:3608413 Length:302 Species:Mus musculus


Alignment Length:209 Identity:72/209 - (34%)
Similarity:115/209 - (55%) Gaps:22/209 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 VRRKRLWRV-----PWFILLMSFVQISL-----------HWIASE--CMQKVLIFKPEWNVEYWR 109
            |||..|.|.     |.||:|:|..::::           .||..:  .::..|.:.||...|.||
Mouse    57 VRRTYLERANCLPPPLFIILISLAELAVFIYYAVWKPQKQWITLDTGILESPLTYCPEKREEAWR 121

  Fly   110 LLTYMLLHSDYWHLSLNICFQCFIGICLEVEQGHWRLAVVYMVGGVAGSLANAWLQPHLHLMGAS 174
            .::|||:|:...|:..|:..|..:||.||:.....|:.:||:.|.:|||||::...|...|:|||
Mouse   122 FISYMLVHAGVQHIVGNLLMQIVLGIPLEMVHKGLRVGLVYLAGVLAGSLASSIFDPLKSLVGAS 186

  Fly   175 AGVYAMLGSHVPHLVLNFSQLSHRFARIASLLILLL--SDVGFTTY-HFCHNHNRNPRTSLEAHI 236
            .||||::|.:..::::||.::...|..:..|:|:|:  ||:||..| .|....|.:| .|..|||
Mouse   187 GGVYALMGGYFMNVIVNFREMIPAFGIVRLLVIILIVASDMGFALYRRFFVPANGSP-VSFAAHI 250

  Fly   237 GGGVAGILCGFIVY 250
            .||.||:..|:.|:
Mouse   251 AGGFAGMSIGYTVF 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rho-6NP_788038.1 Rhomboid 106..251 CDD:279958 57/148 (39%)
Rhbdl2NP_898986.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..38
Rhomboid 115..264 CDD:366759 56/149 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0705
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000995
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45840
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.