DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rho-6 and Rhbdf2

DIOPT Version :9

Sequence 1:NP_788038.1 Gene:rho-6 / 34640 FlyBaseID:FBgn0032415 Length:263 Species:Drosophila melanogaster
Sequence 2:XP_030101763.1 Gene:Rhbdf2 / 217344 MGIID:2442473 Length:853 Species:Mus musculus


Alignment Length:162 Identity:38/162 - (23%)
Similarity:72/162 - (44%) Gaps:17/162 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 CMQKVL----IFKPEWNVEYWRLLTYMLLHSDYWHLSLNICFQCFIGICLEVEQGHWRLAVVYMV 152
            |:.||.    ...||...:::|:...:.||:...|..:::.||..|...||...|..|:::::::
Mouse   632 CLDKVCGLLPFLNPEVPDQFYRIWLSLFLHAGIVHCLVSVVFQMTILRDLEKLAGWHRISIIFIL 696

  Fly   153 GGVAGSLANAWLQPHLHLMGASAGVYAMLGSHVPHLVLNFSQLSHRFARIASL--LILLLSDVGF 215
            .|:.|:||:|...|:...:|.:...:.:|......|..::..|...:....:|  ::|.|...|.
Mouse   697 SGITGNLASAIFLPYRAEVGPAGSQFGLLACLFVELFQSWQLLERPWKAFFNLSAIVLFLFICGL 761

  Fly   216 TTYHFCHNHNRNPRTSLEAHIGGGVAGILCGF 247
            .           |.....|||.|.::|:|..|
Mouse   762 L-----------PWIDNIAHIFGFLSGMLLAF 782

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rho-6NP_788038.1 Rhomboid 106..251 CDD:279958 33/144 (23%)
Rhbdf2XP_030101763.1 Rhomboid_SP 98..328 CDD:372211
Rhomboid 648..788 CDD:366759 33/146 (23%)
MFS 746..>836 CDD:391944 12/48 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0705
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1253228at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.