DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rho-6 and Rhbdl1

DIOPT Version :9

Sequence 1:NP_788038.1 Gene:rho-6 / 34640 FlyBaseID:FBgn0032415 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_659065.1 Gene:Rhbdl1 / 214951 MGIID:2384891 Length:373 Species:Mus musculus


Alignment Length:204 Identity:57/204 - (27%)
Similarity:97/204 - (47%) Gaps:17/204 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 RKRLWRVPWFILLMSFVQISL---------HWIAS----ECMQKVLIFKPEWNVEYWRLLTYMLL 116
            |.|....|.|:..::..||.:         .|:..    |.|:..|::.|......||.||||.:
Mouse   125 RHRTCPPPVFMASVTLAQIIVFLCYGARLNKWVLQTYHPEYMKSPLVYHPGHRARAWRFLTYMFM 189

  Fly   117 HSDYWHLSLNICFQCFIGICLEVEQGHWRLAVVYMVGGVAGSLANAWLQPHLHLMGASAGVYAML 181
            |.....|..|...|..||:.||:..|..|::::|:.|.:||||..:.......::|.|.||||:.
Mouse   190 HVGLEQLGFNALLQLMIGVPLEMVHGVLRISLLYLAGVLAGSLTVSITDMRAPVVGGSGGVYALC 254

  Fly   182 GSHVPHLVLNFS--QLSHRFARIASLLILLLSDVGFTTY-HFCHN-HNRNPRTSLEAHIGGGVAG 242
            .:|:.::|:|::  :..::..|:...|:.:.|:||...: .|... ....|:.|..||:.|.|.|
Mouse   255 SAHLANVVMNWAGMRCPYKLLRMVLALVCMSSEVGRAVWLRFSPPLPASGPQPSFMAHLAGAVVG 319

  Fly   243 ILCGFIVYR 251
            :..|..:.|
Mouse   320 VSMGLTILR 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rho-6NP_788038.1 Rhomboid 106..251 CDD:279958 45/148 (30%)
Rhbdl1NP_659065.1 Rhomboid 174..328 CDD:279958 46/153 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0705
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1253228at2759
OrthoFinder 1 1.000 - - FOG0000995
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45840
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
87.880

Return to query results.
Submit another query.