DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rho-6 and rom-2

DIOPT Version :9

Sequence 1:NP_788038.1 Gene:rho-6 / 34640 FlyBaseID:FBgn0032415 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_001366679.1 Gene:rom-2 / 183564 WormBaseID:WBGene00004401 Length:348 Species:Caenorhabditis elegans


Alignment Length:206 Identity:57/206 - (27%)
Similarity:105/206 - (50%) Gaps:18/206 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 PWFILLMSFVQISLH-----------WIASECMQKVLIFKPEWNV-EYWRLLTYMLLHSDYWHLS 124
            |.|::.:|.||::.:           |::........:...:::: |.|||.||.|::...:|:.
 Worm   122 PIFLIFLSIVQLAFYLYYVVDSSEGVWLSGPIPTMSPLIVSQYHLPELWRLFTYCLINVGIFHII 186

  Fly   125 LNICFQCFIGICLEVEQGHWRLAVVYMVGGVAGSLANAWLQPHLHLMGASAGVYAMLGSHVPHLV 189
            .||..|..||:.||:.. .||:.::|.:|.:.||:.:..|.|.:.|.|.:||.::::.||:..:.
 Worm   187 FNILIQLAIGVPLELVH-RWRIYILYFMGVLFGSILSLALDPTVFLCGGAAGSFSLIASHITTIA 250

  Fly   190 LNFSQLSHRFARIASLLILLLSDVGFTTYH--FCHNHNRNPRTSLEAHIGGGVAGILCGFIVYRR 252
            .||.::.:...|:..|::....|.....|.  |.   .|..:.|:..|:||.|||||..||::|.
 Worm   251 TNFKEMENATCRLPILIVFAALDYVLAVYQRFFA---PRIDKVSMYGHLGGLVAGILFTFILFRG 312

  Fly   253 LQPANQKAIYF 263
            .:|:....:.|
 Worm   313 SKPSRFYTVSF 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rho-6NP_788038.1 Rhomboid 106..251 CDD:279958 48/146 (33%)
rom-2NP_001366679.1 EF-hand_7 21..82 CDD:404394
Rhomboid 165..311 CDD:396315 48/149 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160162537
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0705
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1253228at2759
OrthoFinder 1 1.000 - - FOG0000995
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45840
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
87.810

Return to query results.
Submit another query.