DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rho-6 and RHBDL3

DIOPT Version :9

Sequence 1:NP_788038.1 Gene:rho-6 / 34640 FlyBaseID:FBgn0032415 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_001350764.1 Gene:RHBDL3 / 162494 HGNCID:16502 Length:428 Species:Homo sapiens


Alignment Length:258 Identity:60/258 - (23%)
Similarity:93/258 - (36%) Gaps:82/258 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 DDLTRTIDVGHVRRKRLWRV--------PWFILLMSFVQIS-------------LHWIASECMQK 95
            :.|.|.||       |.|..        |||::.::.::::             |.......::.
Human   142 ETLPREID-------RKWYYDSYTCCPPPWFMITVTLLEVAFFLYNGVSLGQFVLQVTHPRYLKN 199

  Fly    96 VLIFKPEWNVEYWRLLTYMLLHSDYWHLSLNICFQCFIGICLEVEQGHWRLAVVYMVGGVAG--- 157
            .|::.|:...:.||.|||:.:|:...||.||:..|..:|:.||:..|..|:.:||:.|.||.   
Human   200 SLVYHPQLRAQVWRYLTYIFMHAGIEHLGLNVVLQLLVGVPLEMVHGATRIGLVYVAGVVAELVR 264

  Fly   158 -----SLANAWLQPHLHLMGASAGVYAMLGSHVPHLVLNFSQLSHRFARIASLLILLLSDVGFTT 217
                 ..|.....|:|:..|..||                        |:|.|..:.||.|  .:
Human   265 HEVPVQAAADGCGPYLYEHGVWAG------------------------RVAPLPPVGLSPV--PS 303

  Fly   218 YHFC---------HNHNRNPRTSLEAHIGGGVAGI-LCGFIVYRR----------LQPANQKA 260
            ...|         |:..|.....|.|...|.|..: .||.:...|          |.||..||
Human   304 PKLCGALGWRGRGHHPGRGGPEELRAEAPGPVTVVDFCGHVHRLRAVRCLLEHLCLHPAGLKA 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rho-6NP_788038.1 Rhomboid 106..251 CDD:279958 42/162 (26%)
RHBDL3NP_001350764.1 EF-hand_7 36..100 CDD:316058
EF-hand motif 38..67 CDD:320054
Rhomboid 205..>260 CDD:328780 20/54 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144495
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0705
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1253228at2759
OrthoFinder 1 1.000 - - FOG0000995
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45840
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
87.810

Return to query results.
Submit another query.