DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rho-6 and Rhbdf1

DIOPT Version :9

Sequence 1:NP_788038.1 Gene:rho-6 / 34640 FlyBaseID:FBgn0032415 Length:263 Species:Drosophila melanogaster
Sequence 2:XP_036012182.1 Gene:Rhbdf1 / 13650 MGIID:104328 Length:926 Species:Mus musculus


Alignment Length:80 Identity:25/80 - (31%)
Similarity:43/80 - (53%) Gaps:4/80 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 CMQKVL----IFKPEWNVEYWRLLTYMLLHSDYWHLSLNICFQCFIGICLEVEQGHWRLAVVYMV 152
            ||..|.    ...||...:::||...:.||:...|..:::|||..:...||...|..|:|::|::
Mouse   683 CMDDVCGLLPFLNPEVPDQFYRLWLSLFLHAGILHCLVSVCFQMTVLRDLEKLAGWHRIAIIYLL 747

  Fly   153 GGVAGSLANAWLQPH 167
            .|:.|:||:|...|:
Mouse   748 SGITGNLASAIFLPY 762

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rho-6NP_788038.1 Rhomboid 106..251 CDD:279958 20/62 (32%)
Rhbdf1XP_036012182.1 Rhomboid_SP 139..356 CDD:403706
Rhomboid 696..>762 CDD:419717 21/65 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0705
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S5508
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1253228at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.770

Return to query results.
Submit another query.