DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rho-6 and rhbdl3

DIOPT Version :9

Sequence 1:NP_788038.1 Gene:rho-6 / 34640 FlyBaseID:FBgn0032415 Length:263 Species:Drosophila melanogaster
Sequence 2:XP_031750644.1 Gene:rhbdl3 / 101732375 -ID:- Length:350 Species:Xenopus tropicalis


Alignment Length:244 Identity:68/244 - (27%)
Similarity:113/244 - (46%) Gaps:50/244 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 KKFI-----DDLTRTIDVGHVRRKRLW--------RVPWFILLMSFVQISLHWIASECMQKV--- 96
            ::||     :.|.|.||       |.|        ..||||:.::.|:::........:.:.   
 Frog    74 QRFIRHMAYETLPREID-------RKWFYDNYTGCPPPWFIITVTIVEVAAFVYYGLVLDRFVLQ 131

  Fly    97 -----------LIFKPEWNVEYWRLLTYMLLHSDYWHLSLNICFQCFIGICLEVEQGHWRLAVVY 150
                       |::.|:..|:.||.|:||.:|:...||.:|:..|..:|:.||:..|..|::.||
 Frog   132 ATHPRYLRNNPLVYHPQVRVQAWRYLSYMFMHAGIEHLGVNVALQLLVGVPLEMVHGAVRISFVY 196

  Fly   151 MVGGVAGSLANAWLQPHLHLMGASAGVYAMLGSHVPHLVLNFSQLSHRFARIASLLILLLSDVGF 215
            :.|.:|||||.:........:||||||||:|.:|:.::|:|:|.:..:|..:.:...|:.....|
 Frog   197 IAGILAGSLAVSVADTSAPAVGASAGVYALLSAHLANIVMNWSGMKCQFKLLRTAFALICMSFEF 261

  Fly   216 ----------TTYHFCHNHNRNPRTSLEAHIGGGVAGILCGFIVYRRLQ 254
                      :.|..|      |..|..||:||.:.||..|.|..|..:
 Frog   262 GRAVWLRLYPSAYAPC------PHPSFVAHLGGVLVGITLGVITLRNYE 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rho-6NP_788038.1 Rhomboid 106..251 CDD:279958 51/154 (33%)
rhbdl3XP_031750644.1 Rhomboid 152..301 CDD:396315 51/154 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1253228at2759
OrthoFinder 1 1.000 - - FOG0000995
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.