DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phae2 and KLK4

DIOPT Version :9

Sequence 1:NP_001285871.1 Gene:Phae2 / 34638 FlyBaseID:FBgn0263235 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_004908.4 Gene:KLK4 / 9622 HGNCID:6365 Length:254 Species:Homo sapiens


Alignment Length:263 Identity:64/263 - (24%)
Similarity:108/263 - (41%) Gaps:44/263 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LLLAVCVSQGSGLALDQPEGRVVGGKAAAANSAPYIVSMQYGGTHYCAANIINSNWLVTAAHCLA 75
            |:|.|..|..||..     .:::.|:..:.:|.|:..::......:|:..:::..|:::||||..
Human    15 LILGVAGSLVSGSC-----SQIINGEDCSPHSQPWQAALVMENELFCSGVLVHPQWVLSAAHCFQ 74

  Fly    76 N------------RNQVLGSTLVAGSIAVAGTASTTQKRQITHYVINDLYTGGTVPYDIGLIYTP 128
            |            .:|..||.:|..|::|.                :..|....:..|:.||...
Human    75 NSYTIGLGLHSLEADQEPGSQMVEASLSVR----------------HPEYNRPLLANDLMLIKLD 123

  Fly   129 TAFTWTAAVAPVKLPSSGVRPTGKADLFGWGSTSKTNSPSYPKTLQEAKNIPIISLDSCAAALGS 193
            .:.:.:..:..:.:.|..........:.|||..:....|    |:.:..|:.::|.:.|     |
Human   124 ESVSESDTIRSISIASQCPTAGNSCLVSGWGLLANGRMP----TVLQCVNVSVVSEEVC-----S 179

  Fly   194 KGQD--VHTTNLCTGPLTGGTSFCTSDSGGPLVQGNVLIGIVSWGKLPCGQPNSPSVYVQVSSFI 256
            |..|  .|.:..|.|........|..||||||:....|.|:||:||.||||...|.||..:..|.
Human   180 KLYDPLYHPSMFCAGGGQDQKDSCNGDSGGPLICNGYLQGLVSFGKAPCGQVGVPGVYTNLCKFT 244

  Fly   257 TWI 259
            .||
Human   245 EWI 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phae2NP_001285871.1 Tryp_SPc 31..259 CDD:214473 56/241 (23%)
Tryp_SPc 32..262 CDD:238113 58/242 (24%)
KLK4NP_004908.4 Tryp_SPc 31..250 CDD:238113 58/242 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147447
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.