DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phae2 and tmprss7

DIOPT Version :9

Sequence 1:NP_001285871.1 Gene:Phae2 / 34638 FlyBaseID:FBgn0263235 Length:265 Species:Drosophila melanogaster
Sequence 2:XP_002666699.2 Gene:tmprss7 / 798480 ZFINID:ZDB-GENE-130530-883 Length:840 Species:Danio rerio


Alignment Length:244 Identity:76/244 - (31%)
Similarity:115/244 - (47%) Gaps:22/244 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 PEGRVVGGKAAAANSAPYIVSMQYGGTHYCAANIINSNWLVTAAHCLANRNQVLGSTLVAGSIAV 92
            |:.|:|||..|.....|:.|||.:.|..||.|::::..||::||||. ::.::....:....:.:
Zfish   598 PQQRIVGGVNAVEGEWPWQVSMHFSGQLYCGASVLSDVWLISAAHCY-SKERLADPRMWMAHLGM 661

  Fly    93 AGTASTTQKRQITHYVINDLYTGGTVPYDIGLIYTPTAFTWTAA----VAPVKLPSSGVRPT--G 151
            ....|.....:|...|:::.|......|||.|:....  .|.:.    :.||.||:.....|  .
Zfish   662 LNQGSAKHVAEIRRIVVHEYYNARNFDYDIALLQLKK--VWPSGLEQYIQPVCLPAPSQTFTEGH 724

  Fly   152 KADLFGWGSTSKTNSPSYPKTLQEAKNIPIISLDSCAAALGSKGQDVHTTNLCTGPLTGGTSFCT 216
            :..:.|||..|:.:. ..|..||:|: :.::|...|..:.|    .|....||.|..:|....|.
Zfish   725 RCWVTGWGYRSEQDK-VLPTVLQKAE-VNVLSQSECKRSYG----PVSPRMLCAGVPSGEQDACR 783

  Fly   217 SDSGGPL-VQGNV-----LIGIVSWGKLPCGQPNSPSVYVQVSSFITWI 259
            .|||||| .|...     |.||||||. .||:|..|.||.:|:.||.||
Zfish   784 GDSGGPLSCQAQTGSRWFLTGIVSWGS-GCGRPYLPGVYTRVAKFIDWI 831

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phae2NP_001285871.1 Tryp_SPc 31..259 CDD:214473 73/239 (31%)
Tryp_SPc 32..262 CDD:238113 74/240 (31%)
tmprss7XP_002666699.2 SEA 99..203 CDD:307516
CUB <260..344 CDD:238001
CUB 367..465 CDD:294042
LDLa 472..506 CDD:238060
LDLa 546..581 CDD:238060
Tryp_SPc 601..831 CDD:214473 73/239 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.