DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phae2 and st14b

DIOPT Version :9

Sequence 1:NP_001285871.1 Gene:Phae2 / 34638 FlyBaseID:FBgn0263235 Length:265 Species:Drosophila melanogaster
Sequence 2:XP_005161261.1 Gene:st14b / 777629 ZFINID:ZDB-GENE-061103-613 Length:864 Species:Danio rerio


Alignment Length:242 Identity:80/242 - (33%)
Similarity:125/242 - (51%) Gaps:20/242 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 RVVGGKAAAANSAPYIVS--MQYGGTHYCAANIINSNWLVTAAHCLANRNQVLGSTLVAGSIAVA 93
            |:||||.:.....|:.||  |:..| |.|.|::|:::||||||||:.:.:|...|......:.:.
Zfish   624 RIVGGKDSDEGEWPWQVSLHMKTQG-HVCGASVISNSWLVTAAHCVQDNDQFRYSQADQWEVYLG 687

  Fly    94 ----GTASTTQKRQITHYVINDLYTGGTVPYDIGLIYTPTAFTWTAAVAPVKLPS-SGVRPTGKA 153
                |..|.:.:|.:...:.:..|...:...||.|:...:..|....:.|:.||. :...|.||:
Zfish   688 LHNQGETSKSTQRSVLRIIPHPQYDHSSYDNDIALMELDSPVTLNQNIWPICLPDPTHYFPAGKS 752

  Fly   154 D-LFGWGSTSKTNSPSYPKTLQEAKNIPIISLDSCAAALGSKGQDVHTTNLCTGPLTGGTSFCTS 217
            . :.|||.. :..|.:.|..||:|: :.||:...| :.|...|...|.  :|.|.|:||...|..
Zfish   753 VWITGWGKL-REGSDAVPSVLQKAE-VRIINSTVC-SKLMDDGITPHM--ICAGVLSGGVDACQG 812

  Fly   218 DSGGPL--VQGN---VLIGIVSWGKLPCGQPNSPSVYVQVSSFITWI 259
            |||||:  ::||   .|.|:||||. .||:.|.|.||.:|:.:.:||
Zfish   813 DSGGPMSSIEGNGRMFLAGVVSWGD-GCGRRNRPGVYTRVTDYRSWI 858

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phae2NP_001285871.1 Tryp_SPc 31..259 CDD:214473 78/240 (33%)
Tryp_SPc 32..262 CDD:238113 79/241 (33%)
st14bXP_005161261.1 SEA 92..180 CDD:279699
CUB 233..342 CDD:238001
CUB 351..457 CDD:238001
LDLa 465..497 CDD:238060
LDLa 499..533 CDD:238060
LDLa 536..570 CDD:238060
LDLa 578..613 CDD:238060
Tryp_SPc 624..858 CDD:214473 78/240 (33%)
Tryp_SPc 625..861 CDD:238113 79/241 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.