DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phae2 and Prss44

DIOPT Version :9

Sequence 1:NP_001285871.1 Gene:Phae2 / 34638 FlyBaseID:FBgn0263235 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_683742.2 Gene:Prss44 / 73336 MGIID:1920586 Length:372 Species:Mus musculus


Alignment Length:250 Identity:81/250 - (32%)
Similarity:112/250 - (44%) Gaps:41/250 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 RVVGGKAAAANSAPYIVSMQYGGTHYCAANIINSNWLVTAAHCLANRNQVLGSTLVAGSIAVA-- 93
            |:|||:.|.|...|:.||:|....|.|..::|:..|::|||||            |.|.:..|  
Mouse   111 RIVGGRPAPARKWPWQVSLQVHKQHICGGSLISKWWVITAAHC------------VYGHLDYAVF 163

  Fly    94 -GTASTTQKRQ--------ITHYVINDLYTGGTVPYDIGLIYTPTAFTWTAAVAPVKLPSSG--V 147
             |.|....||.        |.|   .|.....||.:||.|:.......::..:.||.:|...  |
Mouse   164 MGDADLWSKRPVRIPVQDIIVH---QDFSMMRTVVHDIALVLLAFPVNYSVNIQPVCIPEKSFLV 225

  Fly   148 RPTGKADLFGWGSTSKTNSPSYPKTLQEAKNIPIISLDSCAAAL----GSKGQDVHTTNLCTGPL 208
            :|.....:.|||...:....|  :.|||.: :.||..:.|...|    |:....|....:|....
Mouse   226 QPGTLCWVTGWGKVLEQGRSS--RILQEIE-LNIIRHEKCNQILKDIMGNIFTLVQEGGVCGYNE 287

  Fly   209 TGGTSFCTSDSGGPLV-QGN---VLIGIVSWGKLPCGQPNSPSVYVQVSSFITWI 259
            .||.: |..||||||| :.|   |.:|||||| |.||:...|.||.:||.:..||
Mouse   288 KGGDA-CQGDSGGPLVCEFNKTWVQVGIVSWG-LGCGRIGYPGVYTEVSYYRDWI 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phae2NP_001285871.1 Tryp_SPc 31..259 CDD:214473 79/248 (32%)
Tryp_SPc 32..262 CDD:238113 79/248 (32%)
Prss44NP_683742.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 31..72
Tryp_SPc 111..340 CDD:214473 79/248 (32%)
Tryp_SPc 112..340 CDD:238113 78/247 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.