DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phae2 and Prss57

DIOPT Version :9

Sequence 1:NP_001285871.1 Gene:Phae2 / 34638 FlyBaseID:FBgn0263235 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001036175.1 Gene:Prss57 / 73106 MGIID:1920356 Length:284 Species:Mus musculus


Alignment Length:234 Identity:80/234 - (34%)
Similarity:123/234 - (52%) Gaps:15/234 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 VVGGKAAAANSAPYIVSMQYGGTHYCAANIINSNWLVTAAHCLANRNQVLGSTLVAGSIAVAGTA 96
            :|||.....:|.||:.|:.:.|.|||...:|:::|:|:||||.::|:..:| .:|.|:.|:....
Mouse    40 IVGGHEVTPHSRPYMASVSFEGHHYCGGFLIHTHWVVSAAHCFSDRDPSMG-LVVLGAHALLAPE 103

  Fly    97 STTQKRQITHYVINDLYTGGTVPYDIGLIYTPTAFTWTAAVAPVKLPSSGVRPTG---KADLFGW 158
            .|.|...|...|.:..:...|...||.|:....:.....||..::||....:|..   :..:.||
Mouse   104 PTQQTFSIAAAVSHPDFQPATQANDICLLRLNGSAVLGPAVRLLRLPRRNAKPPAAGTRCHVSGW 168

  Fly   159 GSTSKTNSPSYPKTLQEAKNIPIISLDSCAAALGSKGQDVHTTNLCTGPLTGG---TSFCTSDSG 220
            |..|....|  |..|.|.: :.|:.|..|.::.  :|| ::...|||.  :|.   ..||::|||
Mouse   169 GFVSDFEEP--PPGLMEVE-VRILDLSVCNSSW--QGQ-LNPAMLCTH--SGDRRRRGFCSADSG 225

  Fly   221 GPLVQGNVLIGIVSWGKLPCGQPNSPSVYVQVSSFITWI 259
            ||||.|....|:||:..|.||.|.:|.||.|||:|:|||
Mouse   226 GPLVCGRRAHGLVSFSGLWCGDPKTPDVYTQVSAFVTWI 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phae2NP_001285871.1 Tryp_SPc 31..259 CDD:214473 78/232 (34%)
Tryp_SPc 32..262 CDD:238113 80/234 (34%)
Prss57NP_001036175.1 Tryp_SPc 40..264 CDD:238113 78/232 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S6011
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.860

Return to query results.
Submit another query.