DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phae2 and Klk12

DIOPT Version :9

Sequence 1:NP_001285871.1 Gene:Phae2 / 34638 FlyBaseID:FBgn0263235 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_081373.1 Gene:Klk12 / 69511 MGIID:1916761 Length:247 Species:Mus musculus


Alignment Length:253 Identity:83/253 - (32%)
Similarity:119/253 - (47%) Gaps:22/253 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 ILLLAVCVSQGSGLALDQPEGRVVGGKAAAANSAPYIVSMQYGGTHYCAANIINSNWLVTAAHCL 74
            :||.||.:||..       ..::..|.....||.|:.|.:.:|....|...:::..|::||||| 
Mouse     7 LLLCAVGLSQAD-------REKIYNGVECVKNSQPWQVGLFHGKYLRCGGVLVDRKWVLTAAHC- 63

  Fly    75 ANRNQVLGSTLVAGSIAVAGTASTTQKRQITHYVINDLYTGG--TVPYDIGLIYTPTAFTWTAAV 137
              |::.:   :..|..::.....|.|.|..|..:.:..|.|.  ...:|:.|:........|.||
Mouse    64 --RDKYV---VRLGEHSLTKLDWTEQLRHTTFSITHPSYQGAYQNHEHDLRLLRLNRPIHLTRAV 123

  Fly   138 APVKLPSSGVRPTGKADLFGWGSTSKTNSPSYPKTLQEAKNIPIISLDSCAAALGSKGQDVHTTN 202
            .||.||||.|.......:.|||:|:|...| :|..|| ..|:..:|.::|.|....:   |....
Mouse   124 RPVALPSSCVTTGAMCHVSGWGTTNKPWDP-FPDRLQ-CLNLSTVSNETCRAVFPGR---VTENM 183

  Fly   203 LCTGPLTGGTSFCTSDSGGPLVQGNVLIGIVSWGKL-PCGQPNSPSVYVQVSSFITWI 259
            ||.|. ..|...|..|||||||.|.||.|:||||.: ||||...|.||.:|..:..||
Mouse   184 LCAGG-EAGKDACQGDSGGPLVCGGVLQGLVSWGSVGPCGQKGIPGVYTKVCKYTDWI 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phae2NP_001285871.1 Tryp_SPc 31..259 CDD:214473 75/230 (33%)
Tryp_SPc 32..262 CDD:238113 77/231 (33%)
Klk12NP_081373.1 Tryp_SPc 21..240 CDD:214473 75/230 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167837420
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.