DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phae2 and st14a

DIOPT Version :9

Sequence 1:NP_001285871.1 Gene:Phae2 / 34638 FlyBaseID:FBgn0263235 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001035441.2 Gene:st14a / 678603 ZFINID:ZDB-GENE-030131-6496 Length:834 Species:Danio rerio


Alignment Length:242 Identity:77/242 - (31%)
Similarity:116/242 - (47%) Gaps:18/242 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 EGRVVGGKAAAANSAPYIVSMQYGG-THYCAANIINSNWLVTAAHCLANRNQVL----GSTLVAG 88
            :.|:|||:.|.....|:.||:.... .|.|..:|||..|:||||||:.:..::.    |:..|..
Zfish   594 KSRIVGGQDAFEGEFPWQVSLHIKNIAHVCGGSIINERWIVTAAHCVQDDVKIKYSQPGTWEVFL 658

  Fly    89 SIAVAGTASTTQKRQITHYVINDLYTGGTVPYDIGLIYTPTAFTWTAAVAPVKLP-SSGVRPTG- 151
            .:.......|..||.:...:.:..|...|...||.|:...:..|::..:.||.|| ::...|.| 
Zfish   659 GLHSQKDKLTATKRLLKQVIPHPYYNAYTYDNDIALMEMESPVTFSDTIRPVCLPTATDTFPAGT 723

  Fly   152 KADLFGWGSTSKTNSPSYPKTLQEAKNIPIISLDSCAAALGSKGQDVHTTNLCTGPLTGGTSFCT 216
            ...:.|||:|.:..|.:  ..||:|: :.||:...|...:|  || :.:...|.|.|:||...|.
Zfish   724 SVFISGWGATREGGSGA--TVLQKAE-VRIINSTVCNQLMG--GQ-ITSRMTCAGVLSGGVDACQ 782

  Fly   217 SDSGGPLV----QGNVLIGIVSWGKLPCGQPNSPSVYVQVSSFITWI 259
            .||||||.    :...|.|:||||. .|.:.|.|.:|..|..|..||
Zfish   783 GDSGGPLSFPSGKRMFLAGVVSWGD-GCARRNKPGIYSNVPKFRAWI 828

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phae2NP_001285871.1 Tryp_SPc 31..259 CDD:214473 75/238 (32%)
Tryp_SPc 32..262 CDD:238113 76/239 (32%)
st14aNP_001035441.2 SEA 77..168 CDD:279699
CUB 219..322 CDD:238001
CUB 329..431 CDD:238001
LDLa 443..472 CDD:238060
LDLa 474..508 CDD:238060
LDLa 510..544 CDD:238060
LDLa 550..585 CDD:238060
Tryp_SPc 596..828 CDD:214473 75/238 (32%)
Tryp_SPc 597..831 CDD:238113 76/239 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.