DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phae2 and ST14

DIOPT Version :9

Sequence 1:NP_001285871.1 Gene:Phae2 / 34638 FlyBaseID:FBgn0263235 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_068813.1 Gene:ST14 / 6768 HGNCID:11344 Length:855 Species:Homo sapiens


Alignment Length:293 Identity:94/293 - (32%)
Similarity:127/293 - (43%) Gaps:57/293 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LLAVCVSQGS--------------------GLALDQPEGRVVGGKAAAANSAPYIVSMQ-YGGTH 55
            |..:|:|:|:                    ||.....:.|||||..|.....|:.||:. .|..|
Human   575 LNGLCLSKGNPECDGKEDCSDGSDEKDCDCGLRSFTRQARVVGGTDADEGEWPWQVSLHALGQGH 639

  Fly    56 YCAANIINSNWLVTAAHCLANRNQVLGS-----TLVAG-----SIAVAGTASTTQKRQITHYVIN 110
            .|.|::|:.||||:||||..:......|     |...|     ..:..|......||.|:|...|
Human   640 ICGASLISPNWLVSAAHCYIDDRGFRYSDPTQWTAFLGLHDQSQRSAPGVQERRLKRIISHPFFN 704

  Fly   111 DLYTGGTVPYDIGLIYTPTAFTWTAAVAPVKLP-SSGVRPTGKAD-LFGWGSTSKTNSPSYPKT- 172
            |.    |..|||.|:.......:::.|.|:.|| :|.|.|.|||. :.|||.|      .|..| 
Human   705 DF----TFDYDIALLELEKPAEYSSMVRPICLPDASHVFPAGKAIWVTGWGHT------QYGGTG 759

  Fly   173 ---LQEAKNIPIISLDSCAAALGSKGQDVHTTNLCTGPLTGGTSFCTSDSGGPL----VQGNVL- 229
               ||:.: |.:|:..:|...|   .|.:....:|.|.|:||...|..||||||    ..|.:. 
Human   760 ALILQKGE-IRVINQTTCENLL---PQQITPRMMCVGFLSGGVDSCQGDSGGPLSSVEADGRIFQ 820

  Fly   230 IGIVSWGKLPCGQPNSPSVYVQVSSFITWIAAN 262
            .|:||||. .|.|.|.|.||.::..|..||..|
Human   821 AGVVSWGD-GCAQRNKPGVYTRLPLFRDWIKEN 852

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phae2NP_001285871.1 Tryp_SPc 31..259 CDD:214473 85/249 (34%)
Tryp_SPc 32..262 CDD:238113 86/251 (34%)
ST14NP_068813.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
SEA 88..>171 CDD:307516
CUB 227..332 CDD:238001
CUB 340..444 CDD:238001
LDLa 454..486 CDD:238060
LDLa 488..523 CDD:238060
LDLa 525..559 CDD:238060
LDLa 567..602 CDD:238060 4/26 (15%)
Tryp_SPc 615..852 CDD:238113 86/251 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.