DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phae2 and tmprss5

DIOPT Version :9

Sequence 1:NP_001285871.1 Gene:Phae2 / 34638 FlyBaseID:FBgn0263235 Length:265 Species:Drosophila melanogaster
Sequence 2:XP_009289870.1 Gene:tmprss5 / 569688 ZFINID:ZDB-GENE-131121-184 Length:551 Species:Danio rerio


Alignment Length:270 Identity:90/270 - (33%)
Similarity:132/270 - (48%) Gaps:19/270 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MWRHR-HLATILLLAV-CVSQGSGLALDQPEGRVVGGKAAAANSAPYIVSMQYGGTHYCAANIIN 63
            :||.| ..:|..::|: |...|:...|.    |::||..||....|:.||:.|...|.|..:||.
Zfish   283 LWRFRGSCSTGKVIALKCFECGTRAKLP----RIIGGVEAALGRWPWQVSLYYNNRHICGGSIIT 343

  Fly    64 SNWLVTAAHCLAN-RNQVLGSTLVAGSIAVAGTASTTQKR--QITHYVINDLYTGGTVPYDIGLI 125
            :.|:||||||:.| |...:.|.:|...|..:..|...|.:  .:...:.|..|...|...||.|:
Zfish   344 NQWIVTAAHCVHNYRLPQVPSWVVYAGIITSNLAKLAQYQGFAVERIIYNKNYNHRTHDNDIALV 408

  Fly   126 YTPTAFTWTAAVAPVKLPSSGVRPTGKAD--LFGWGSTSKTNSPSYPKTLQEAKNIPIISLDSCA 188
            ...|...::..:.||.||.......|...  :.|||.| :.:....|:.|:||. :|:||...|.
Zfish   409 KLKTPLNFSDTIRPVCLPQYDHDLPGGTQCWISGWGYT-QPDDVLIPEVLKEAP-VPLISTKKCN 471

  Fly   189 AALGSKGQDVHTTNLCTGPLTGGTSFCTSDSGGPLV--QGNV--LIGIVSWGKLPCGQPNSPSVY 249
            ::....| ::.:..||.|...|....|..|||||||  ..||  |:|:|||| ..|.:||.|.||
Zfish   472 SSCMYNG-EITSRMLCAGYSEGKVDACQGDSGGPLVCQDENVWRLVGVVSWG-TGCAEPNHPGVY 534

  Fly   250 VQVSSFITWI 259
            .:|:.|:.||
Zfish   535 SKVAEFLGWI 544

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phae2NP_001285871.1 Tryp_SPc 31..259 CDD:214473 80/236 (34%)
Tryp_SPc 32..262 CDD:238113 81/237 (34%)
tmprss5XP_009289870.1 SRCR_2 211..306 CDD:292133 7/22 (32%)
Tryp_SPc 311..544 CDD:214473 80/236 (34%)
Tryp_SPc 312..547 CDD:238113 81/237 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.