DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phae2 and tmprss9

DIOPT Version :9

Sequence 1:NP_001285871.1 Gene:Phae2 / 34638 FlyBaseID:FBgn0263235 Length:265 Species:Drosophila melanogaster
Sequence 2:XP_021325244.1 Gene:tmprss9 / 562051 ZFINID:ZDB-GENE-050208-573 Length:788 Species:Danio rerio


Alignment Length:243 Identity:82/243 - (33%)
Similarity:116/243 - (47%) Gaps:15/243 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 RVVGGKAAAANSAPYIVSMQYGGTHYCAANIINSNWLVTAAHCLANRNQVLGSTLVAGSIAVAGT 95
            |:|||:.......|:.||::..|.|.|.|:|:||.|||:||||....|.....|.:.|:..|:|.
Zfish   231 RIVGGENTRHGEFPWQVSLRLRGRHTCGASIVNSRWLVSAAHCFEVENNPKDWTALVGANQVSGA 295

  Fly    96 ASTTQKRQITHYVINDLYTGGTVPYDIGLIYTPTAFTWTAAVAPVKLPSSG--VRPTGKADLFGW 158
            .:......|...|::..|...|...|:.::...|...::..|.||.:|||.  ..|.....:.||
Zfish   296 EAEAFIVNIKSLVMSPKYDPMTTDSDVTVLELETPLKFSHYVQPVCIPSSSHVFTPGQNCIVSGW 360

  Fly   159 GSTSKTNSPSYPKTLQEAKNIPIIS-LDSCAAALGSKGQDVHTTN-LCTGPLTGGTSFCTSDSGG 221
            |:.::..: ..|.|||:|    |:. :||......|..:...|.| :|.|.|.|....|..||||
Zfish   361 GALNQYTT-EVPSTLQKA----IVKIIDSKVCNKSSVYRGALTQNMMCAGFLQGKVDSCQGDSGG 420

  Fly   222 PL----VQGN-VLIGIVSWGKLPCGQPNSPSVYVQVSSFITWIAANQK 264
            ||    ..|. .|.|||||| :.|.|.|.|.||.:|:....||.:..|
Zfish   421 PLACEVAAGRYFLAGIVSWG-VGCAQINKPGVYSRVTKLRNWIVSYTK 467

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phae2NP_001285871.1 Tryp_SPc 31..259 CDD:214473 79/236 (33%)
Tryp_SPc 32..262 CDD:238113 80/238 (34%)
tmprss9XP_021325244.1 SEA 52..146 CDD:307516
LDLa 185..220 CDD:238060
Tryp_SPc 232..462 CDD:238113 78/235 (33%)
LDLa 510..544 CDD:238060
Tryp_SPc 557..783 CDD:238113
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.