DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phae2 and prss60.2

DIOPT Version :9

Sequence 1:NP_001285871.1 Gene:Phae2 / 34638 FlyBaseID:FBgn0263235 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001099071.1 Gene:prss60.2 / 541408 ZFINID:ZDB-GENE-050320-109 Length:328 Species:Danio rerio


Alignment Length:278 Identity:101/278 - (36%)
Similarity:141/278 - (50%) Gaps:29/278 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MWRHRHLATILLLAVCVSQGSGLALD----QP-EGRVVGGKAAAANSAPYIVSMQ---YGGTHYC 57
            ||| ...||:.|| :|| :||...|:    .| ..|:|||..|...|.|:.||:|   ||| |:|
Zfish     1 MWR-LTCATLTLL-ICV-KGSLSQLNVCGQAPLNSRIVGGVNAPEGSWPWQVSLQSPRYGG-HFC 61

  Fly    58 AANIINSNWLVTAAHCLANRNQVLGSTLVA--GSIAVAGTASTTQKRQITHYVINDLYTGGTVPY 120
            ..::|:|.|::||||||..   |..|:||.  |.....|..:....|.:...:::..|...|...
Zfish    62 GGSLISSEWVLTAAHCLPG---VSESSLVVYLGRRTQQGVNTHETSRNVAKIIVHSSYNSNTNDN 123

  Fly   121 DIGLIYTPTAFTWTAAVAPVKLPS-SGVRPTGKAD-LFGWGST-SKTNSPSYPKTLQEAKNIPII 182
            ||.|:...:|.|:...:.||.|.: :.|...|.:. :.|||.. :..|.|: |..|||.. ||::
Zfish   124 DIALLRLSSAVTFNDYIRPVCLAAQNSVYSAGTSSWITGWGDVQAGVNLPA-PGILQETM-IPVV 186

  Fly   183 SLDSCAAALGSKGQDVHTTNLCTGPLTGGTSFCTSDSGGPLVQGNVLI----GIVSWGKLPCGQP 243
            :.|.|.|.|||  ..|....:|.|...||...|..|||||:|.....:    ||.||| ..|..|
Zfish   187 ANDRCNAQLGS--GTVTNNMICAGLAKGGKDTCQGDSGGPMVTRLCTVWIQAGITSWG-YGCADP 248

  Fly   244 NSPSVYVQVSSFITWIAA 261
            |||.||.:||.:.:||::
Zfish   249 NSPGVYTRVSQYQSWISS 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phae2NP_001285871.1 Tryp_SPc 31..259 CDD:214473 86/239 (36%)
Tryp_SPc 32..262 CDD:238113 87/242 (36%)
prss60.2NP_001099071.1 Tryp_SPc 33..264 CDD:214473 86/239 (36%)
Tryp_SPc 34..267 CDD:238113 87/242 (36%)
Somatomedin_B 296..326 CDD:295334
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.