DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phae2 and prss36

DIOPT Version :9

Sequence 1:NP_001285871.1 Gene:Phae2 / 34638 FlyBaseID:FBgn0263235 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001005710.1 Gene:prss36 / 448231 XenbaseID:XB-GENE-5892976 Length:719 Species:Xenopus tropicalis


Alignment Length:256 Identity:82/256 - (32%)
Similarity:126/256 - (49%) Gaps:18/256 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 GSGLALDQPEGRVVGGKAAAANSAPYIVSMQYGGTHYCAANIINSNWLVTAAHCLANRNQVLGST 84
            ||.|.    ..|:|||..|...:.|:.||::|.|:|.|..::|.:.|::|||||..|........
 Frog   377 GSPLV----SSRIVGGTDAREGAWPWQVSLRYRGSHICGGSVIGTQWILTAAHCFENSQFPSDYE 437

  Fly    85 LVAGSIAVAGTASTTQKRQITHYVINDLYTGGTVPYDIGLIYTPTAFTWTAAVAPVKLPSSGVRP 149
            :..|:..:|.|:.......:...::|..:...|:..||.||...:..|:|..:.||.|||:....
 Frog   438 VRLGTYRLAQTSPNEITYTVDRIIVNSQFDSSTLFGDIALIRLTSPITYTKYILPVCLPSTSNSF 502

  Fly   150 TGKADLF--GWGSTSKTNSPSYPKTLQEAKNIPIISLDSC------AAALGSKGQDVHTTNLCTG 206
            |...:.:  |||:.|...:..|||||||... |:|:...|      .:.:.:..:.:.:..:|:|
 Frog   503 TDGMECWVTGWGTISLYVNLPYPKTLQEVMT-PLINRTRCDQMYHIDSPVSASSEIIPSDQICSG 566

  Fly   207 PLTGGTSFCTSDSGGPLV---QGN-VLIGIVSWGKLPCGQPNSPSVYVQVSSFITWIAANQ 263
            ...||...|..|||||||   ||. ..|||||||: .|.....|.||..|.::.:|:.|.:
 Frog   567 YSAGGKDSCKGDSGGPLVCKLQGIWYQIGIVSWGE-GCAIAKRPGVYTLVPAYYSWVIAEE 626

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phae2NP_001285871.1 Tryp_SPc 31..259 CDD:214473 77/239 (32%)
Tryp_SPc 32..262 CDD:238113 77/241 (32%)
prss36NP_001005710.1 Tryp_SPc 37..276 CDD:238113
Tryp_SPc 385..622 CDD:238113 76/238 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.