DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phae2 and CG34130

DIOPT Version :9

Sequence 1:NP_001285871.1 Gene:Phae2 / 34638 FlyBaseID:FBgn0263235 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001036759.1 Gene:CG34130 / 4379866 FlyBaseID:FBgn0083966 Length:297 Species:Drosophila melanogaster


Alignment Length:241 Identity:52/241 - (21%)
Similarity:94/241 - (39%) Gaps:40/241 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 RVVGGKAAAANSAPYIVSMQYGGTHYCAANIINSNWLVTAAHCLANRNQVLGSTLVAGSIAVAGT 95
            |..||.|     .|:::.:..|.|..|.|:.:::.:.:|:|:|:.:....:.|.    |:.:..:
  Fly    48 RTSGGHA-----VPWLLRIVDGPTFVCGASYLSALYALTSANCMHSHRSQMESL----SVELVSS 103

  Fly    96 ASTTQKRQITHYVINDLYTGGTVPYDIGLIYTPTAFTWTAA---VAPVKLPSSGVRPTGKAD--- 154
            .|....:..:|...|.|.....|..|         :.|...   ||.::|.:   |..|..:   
  Fly   104 DSRQDNQLDSHDPPNALIRNIIVSKD---------WHWPGTFMDVAVIELTN---RLRGNRNNYV 156

  Fly   155 ------LFGWGSTSKTNSPSYPKTLQEAKNIPIISLDSCAAALGSKGQDVHTTNLCTGPLTGGTS 213
                  |..:.|.|..:..:.|......:.|.:::...|.:|.|:  ..:..|..|.........
  Fly   157 TLCTNPLSSYKSLSVVSYGAGPAENVRTEEIEVLNRMICDSAYGN--FLLRETVACAKEFKRSAD 219

  Fly   214 FCTSDSGGPLVQGNVLIGIVSWGKLPCGQPNSPSVYV---QVSSFI 256
             |...:|.|:..|:.|.|||:|.. .|.:.|.|.::.   ||..||
  Fly   220 -CMFSAGCPVTAGDQLCGIVAWSP-ACKRSNLPGIFTDIHQVKRFI 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phae2NP_001285871.1 Tryp_SPc 31..259 CDD:214473 52/241 (22%)
Tryp_SPc 32..262 CDD:238113 51/240 (21%)
CG34130NP_001036759.1 Trypsin 53..263 CDD:278516 47/234 (20%)
Tryp_SPc 53..256 CDD:304450 45/227 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.