DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phae2 and CG17477

DIOPT Version :9

Sequence 1:NP_001285871.1 Gene:Phae2 / 34638 FlyBaseID:FBgn0263235 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_650598.1 Gene:CG17477 / 42067 FlyBaseID:FBgn0038479 Length:267 Species:Drosophila melanogaster


Alignment Length:252 Identity:78/252 - (30%)
Similarity:118/252 - (46%) Gaps:40/252 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LALDQPEGRVVGGKAAAANSAPYIVSMQ-YGGTHYCAANIINSNWLVTAAHCL----ANRNQVLG 82
            |||   |..:|||:.||...|||.||:| ..|:|.|...||:..|::||.||:    .:|.||  
  Fly    21 LAL---EHFIVGGQNAAEGDAPYQVSLQTLLGSHLCGGAIISDRWIITAGHCVKGYPTSRLQV-- 80

  Fly    83 STLVAGSIAVAGTASTTQKRQITHYVINDLYTGGTVPYDIGLIYTPTAFTWTAAVAPVKLPSSGV 147
               ..|:|..|...:......|   .::..|.......||||::...:.|:.|....|:||:|..
  Fly    81 ---ATGTIRYAEPGAVYYPDAI---YLHCNYDSPKYQNDIGLLHLNESITFNALTQAVELPTSPF 139

  Fly   148 RPTGKADLF--GWGSTSKTNS-PSYPKTLQEAK-NIPIISLDSCAAALGSKGQDVHTTNLCTGPL 208
             |.|.::|.  ||||.|...| ||..:.:|:.. |.|     :|.:.: |..:|:.     .||.
  Fly   140 -PRGASELVFTGWGSQSAAGSLPSQLQRVQQQHLNSP-----ACESMM-SAYEDLE-----LGPC 192

  Fly   209 ------TGGTSFCTSDSGGPLVQGNVLIGIVSWGKLPCGQPNSPSVYVQVSSFITWI 259
                  ......|..|||||||....|:||::: .:||.| ..|.:::.:..:..|:
  Fly   193 HICAYRQANIGACHGDSGGPLVHQGTLVGILNF-FVPCAQ-GVPDIFMNIMYYRDWM 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phae2NP_001285871.1 Tryp_SPc 31..259 CDD:214473 73/242 (30%)
Tryp_SPc 32..262 CDD:238113 74/243 (30%)
CG17477NP_650598.1 Tryp_SPc 27..250 CDD:238113 74/243 (30%)
Tryp_SPc 27..246 CDD:214473 73/240 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449492
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.