DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phae2 and CG10405

DIOPT Version :9

Sequence 1:NP_001285871.1 Gene:Phae2 / 34638 FlyBaseID:FBgn0263235 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001036717.1 Gene:CG10405 / 41996 FlyBaseID:FBgn0038431 Length:268 Species:Drosophila melanogaster


Alignment Length:245 Identity:75/245 - (30%)
Similarity:116/245 - (47%) Gaps:26/245 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 QPEGRVVGGKAAAANSAPYIVSMQYGGTHYCAANIINSNWLVTAAHCL-ANRNQVLGSTLVAGSI 90
            ||:.|:|.|:.|.....||.:|::....|.|.|:|::|||.:|||||: .:..|....||..|||
  Fly    32 QPDSRIVNGREATEGQFPYQLSLRRQTVHICGASILSSNWAITAAHCIDGHEQQPREFTLRQGSI 96

  Fly    91 AVAGTASTTQKRQITHYVINDLYTGGTVPYDIGLIYT-------PTAFTWTAAVAPVKLPSSG-- 146
             :..:..|.|..:..:.  :..|....:.:|:.|:.|       |     ...|||::||:.|  
  Fly    97 -MRTSGGTVQPVKAIYK--HPAYDRADMNFDVALLRTADGALSLP-----LGKVAPIRLPTVGEA 153

  Fly   147 VRPTGKADLFGWGSTSKTNSPSYPKTLQEAKNIPIISLDSCAAALGSKGQDVHTTNLCTGPLTGG 211
            :..:..|.:.|||..| |::|.....| ::..:..::.:.|...|...| .|.....|..  ...
  Fly   154 ISESMPAVVSGWGHMS-TSNPVLSSVL-KSTTVLTVNQEKCHNDLRHHG-GVTEAMFCAA--ARN 213

  Fly   212 TSFCTSDSGGPLVQGNVLIGIVSWGKLPCGQPNSPSVYVQVS--SFITWI 259
            |..|..|||||:.....|||||||| :.|..|..|.||.:::  :...||
  Fly   214 TDACQGDSGGPISAQGTLIGIVSWG-VGCADPYYPGVYTRLAHPTIRRWI 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phae2NP_001285871.1 Tryp_SPc 31..259 CDD:214473 71/239 (30%)
Tryp_SPc 32..262 CDD:238113 72/240 (30%)
CG10405NP_001036717.1 Tryp_SPc 36..262 CDD:214473 71/239 (30%)
Tryp_SPc 37..263 CDD:238113 72/240 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.