DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phae2 and CG3916

DIOPT Version :9

Sequence 1:NP_001285871.1 Gene:Phae2 / 34638 FlyBaseID:FBgn0263235 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_650167.1 Gene:CG3916 / 41484 FlyBaseID:FBgn0038003 Length:267 Species:Drosophila melanogaster


Alignment Length:250 Identity:79/250 - (31%)
Similarity:117/250 - (46%) Gaps:41/250 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 RVVGGKAAAANSAPYIVS--MQYGG--THYCAANIINSNWLVTAAHCLANRNQVLGSTLVAGSIA 91
            |:.||: ....:.|:.||  ||..|  .|:|..:|::...::|||||: .:.:|...::|.|:: 
  Fly    30 RINGGQ-RVNETVPFQVSLQMQRRGRWQHFCGGSIVSGQHVLTAAHCM-EKMKVEDVSVVVGTL- 91

  Fly    92 VAGTASTTQKRQITHYVINDLYTGGTVPYDIGLI-YTPTAFTWTAAVAPVKLPSSGVRP--TGKA 153
             ...|...:.|.:|.:|.........:..||.|: .||          |.:|..|.:..  .|.:
  Fly    92 -NWKAGGLRHRLVTKHVHPQYSMNPRIINDIALVKVTP----------PFRLERSDISTILIGGS 145

  Fly   154 D---------LFGWGSTS-KTNSPSYPKTLQEAKNIPIISLDSCAAALGSKGQDVHTTNLCTGPL 208
            |         |.|||||| .|:|.:.|..|| |.|...||.:.|    ..||..|....:|...:
  Fly   146 DRIGEKVPVRLTGWGSTSPSTSSATLPDQLQ-ALNYRTISNEDC----NQKGFRVTRNEICALAV 205

  Fly   209 TGGTSFCTSDSGGPLVQGNV---LIGIVSWGKLPCGQPNSPSVYVQVSSFITWIA 260
            . |...|..||||||::...   |:||||:|...|.| ..|.||.:||||:.:|:
  Fly   206 Q-GQGACVGDSGGPLIRPGKQPHLVGIVSYGSSTCAQ-GRPDVYTRVSSFLPYIS 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phae2NP_001285871.1 Tryp_SPc 31..259 CDD:214473 78/247 (32%)
Tryp_SPc 32..262 CDD:238113 78/248 (31%)
CG3916NP_650167.1 Tryp_SPc 30..257 CDD:214473 78/247 (32%)
Tryp_SPc 31..260 CDD:238113 78/248 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449488
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.