DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phae2 and CG17404

DIOPT Version :9

Sequence 1:NP_001285871.1 Gene:Phae2 / 34638 FlyBaseID:FBgn0263235 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_650165.2 Gene:CG17404 / 41482 FlyBaseID:FBgn0038001 Length:275 Species:Drosophila melanogaster


Alignment Length:290 Identity:95/290 - (32%)
Similarity:126/290 - (43%) Gaps:56/290 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 ILLLAVCVSQG--SGLALDQPEG----RVVGG-KAAAANSAPYIVSMQY----GGTHYCAANIIN 63
            :||:.|....|  ..|...||.|    |:||| ........||.||:||    |..|:|..:||.
  Fly     7 LLLIGVVALGGVFGRLNSRQPSGYTPHRIVGGADIPPGEHVPYQVSLQYRTRGGQMHFCGGSIIA 71

  Fly    64 SNWLVTAAHCLANRNQVLGSTLVAGSIAVAGTASTTQKRQITHYVINDLYTGGTVPYDIGLIYTP 128
            .|.::|||||....| ....::|||   :.|......:.|:..|.|:..|. ..|..|:.::   
  Fly    72 PNRILTAAHCCQGLN-ASRMSVVAG---IRGLNEKGSRSQVLSYSIHPKYQ-ELVTSDLAVL--- 128

  Fly   129 TAFTWTAAVAPVKLPSSGV-----RPTGK--------ADLFGWGSTSKTNSP-----SYPKTLQE 175
                  :...|:||.:|.:     |..||        ..|.|||.......|     :||..||.
  Fly   129 ------SIKPPLKLNNSTISAIEYRSQGKDFVGGGVPVTLTGWGLRLPVPFPFLDNVNYPNVLQR 187

  Fly   176 AKNIPIISLDSCAAALGSKGQDVHTTNLCT-GPLTGGTSFCTSDSGGPLV----QGNVLIGIVSW 235
             .:...||...|..| |.  :.|..|.:|. ||..|.   |:.|||||||    .|...:||||:
  Fly   188 -MSYHTISNSECRNA-GM--ESVTDTEICARGPFRGA---CSGDSGGPLVMESKNGLQQVGIVSY 245

  Fly   236 GKLPCGQPNSPSVYVQVSSFITWIAANQKK 265
            |.:.||...||.||.:||:|..|| .||.|
  Fly   246 GLVVCGLYISPDVYTRVSTFSDWI-GNQTK 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phae2NP_001285871.1 Tryp_SPc 31..259 CDD:214473 82/255 (32%)
Tryp_SPc 32..262 CDD:238113 83/257 (32%)
CG17404NP_650165.2 Tryp_SPc 34..269 CDD:214473 82/255 (32%)
Tryp_SPc 35..269 CDD:238113 81/254 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449491
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.