DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phae2 and CG16749

DIOPT Version :9

Sequence 1:NP_001285871.1 Gene:Phae2 / 34638 FlyBaseID:FBgn0263235 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_649881.1 Gene:CG16749 / 41111 FlyBaseID:FBgn0037678 Length:265 Species:Drosophila melanogaster


Alignment Length:272 Identity:85/272 - (31%)
Similarity:121/272 - (44%) Gaps:34/272 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LATILLLAVCVSQGSGLALDQPE-GRVVGGKAAAANSAPYIVSMQ-YGGTHYCAANIINSNWLVT 69
            ||...||..     :|::...|: ||||.|..::....|:::||: ..|:|.|..:||:..:::|
  Fly     9 LAVFALLTT-----AGISHGAPQMGRVVNGTDSSVEKYPFVISMRGSSGSHSCGGSIISKQFVMT 68

  Fly    70 AAHCLANRN-QVLGSTLVAGSIAVAGTASTTQKRQITHYVINDLYTGGTVPY-----DIGLIYTP 128
            ||||...|. ..|........|...|......|:.|.|...|        ||     ||.|:...
  Fly    69 AAHCTDGRKASDLSVQYGVTKINATGPNVVRVKKIIQHEDYN--------PYNNYANDISLLLVE 125

  Fly   129 TAFTWT-AAVAPVKLPSSGVRPT-----GKADLFGWGSTSKTNSPSY-PKTLQEAKNIPIISLDS 186
            ..|.:. ..|||||||.......     |:..|.|||..:   :..| ..||||.: :.:.|.:.
  Fly   126 EPFEFDGVTVAPVKLPELAFATPQTDAGGEGVLIGWGLNA---TGGYIQSTLQEVE-LKVYSDEE 186

  Fly   187 CAAALGSKGQDVHTTNLCTGPLTGGTSFCTSDSGGPLVQGNVLIGIVSWGKLPCGQPNSPSVYVQ 251
            |....|  |:.....::|.|...||...|:.||||||:.....:|||||...||.....|.||.:
  Fly   187 CTERHG--GRTDPRYHICGGVDEGGKGQCSGDSGGPLIYNGQQVGIVSWSIKPCTVAPYPGVYCK 249

  Fly   252 VSSFITWIAANQ 263
            ||.::.||..:|
  Fly   250 VSQYVDWIKKSQ 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phae2NP_001285871.1 Tryp_SPc 31..259 CDD:214473 75/241 (31%)
Tryp_SPc 32..262 CDD:238113 76/243 (31%)
CG16749NP_649881.1 Tryp_SPc 29..257 CDD:214473 75/241 (31%)
Tryp_SPc 30..259 CDD:238113 76/242 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.