DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phae2 and Klk1c6

DIOPT Version :9

Sequence 1:NP_001285871.1 Gene:Phae2 / 34638 FlyBaseID:FBgn0263235 Length:265 Species:Drosophila melanogaster
Sequence 2:XP_038942515.1 Gene:Klk1c6 / 408242 RGDID:1303220 Length:262 Species:Rattus norvegicus


Alignment Length:276 Identity:83/276 - (30%)
Similarity:121/276 - (43%) Gaps:27/276 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MWRHRHLATILLLAVCVSQGSGLALDQPEGRVVGGKAAAANSAPYIVSMQYGGTHYCAANIINSN 65
            ||       :.:|.:.:|.|...|....:.|||||.....||.|:.|::.  ....|...:|:.:
  Rat     1 MW-------LQILFLVLSMGRIDAAPPGQSRVVGGYKCEKNSQPWQVAVI--SRSLCGGVLIDPS 56

  Fly    66 WLVTAAHCLANR----NQVLGSTLVAGSIAVAGTASTTQKRQITHYVINDLY-------TGGTVP 119
            |::|||||.:|.    :.:||...::.....|.....:|  ...|...|..:       .|....
  Rat    57 WVITAAHCYSNALSYYHVLLGRNNLSEDEPFAQYRFVSQ--SFPHPDYNPFFMRNHTRQPGDDYS 119

  Fly   120 YDIGLIYTPTAFTWTAAVAPVKLPSSGVRPTGKADLFGWGSTSKTNSPSYPKTLQEAKNIPIISL 184
            .|:.|::.......|..|..:.||:...:........||||| |......|..|| ..||.::|.
  Rat   120 NDLMLLHLSKPADITDGVKVIDLPTEEPKVGSTCLASGWGST-KPLDWELPDDLQ-CVNIHLLSN 182

  Fly   185 DSCAAALGSKGQDVHTTNLCTGPLTGGTSFCTSDSGGPLVQGNVLIGIVSWGKLPCGQPNSPSVY 249
            :.|..|...|..|:   .||.|.|.||...|..||||||:...||.||.|||..||.:||.|::|
  Rat   183 EKCIEAYNEKVTDL---MLCAGDLEGGKDTCKGDSGGPLICDGVLQGITSWGSDPCAEPNMPAIY 244

  Fly   250 VQVSSFITWIAANQKK 265
            .::..|.:||....|:
  Rat   245 TKLIKFTSWIKEVMKE 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phae2NP_001285871.1 Tryp_SPc 31..259 CDD:214473 74/238 (31%)
Tryp_SPc 32..262 CDD:238113 75/240 (31%)
Klk1c6XP_038942515.1 Tryp_SPc 25..257 CDD:238113 75/240 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166341159
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.