DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phae2 and CG10587

DIOPT Version :9

Sequence 1:NP_001285871.1 Gene:Phae2 / 34638 FlyBaseID:FBgn0263235 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001137989.2 Gene:CG10587 / 40318 FlyBaseID:FBgn0037039 Length:289 Species:Drosophila melanogaster


Alignment Length:281 Identity:74/281 - (26%)
Similarity:118/281 - (41%) Gaps:58/281 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LATILLLAVCVSQG---SGLA--LDQP--EGRVVGGKAAA-ANSAPYIVSMQYGGTHYCAANIIN 63
            ||:|.:||..::|.   :.||  :.:|  :.|||||.... |....|:::::|.....|...:::
  Fly    14 LASIEVLAQDLNQTIDVNKLAKIVQRPGFQTRVVGGDVTTNAQLGGYLIALRYEMNFVCGGTLLH 78

  Fly    64 SNWLVTAAHCLANRNQVLGSTLVAGSIAVAGTASTTQK---RQITHYVINDLYTGGTVPYDIGLI 125
            ...::|||||.      ||...::..:||.|.:....:   ||:...:.:..:....:..|:   
  Fly    79 DLIVLTAAHCF------LGRVKISDWLAVGGASKLNDRGIQRQVKEVIKSAEFREDDMNMDV--- 134

  Fly   126 YTPTAFTWTAAVAPVKLPSSG------------VRPTGKADLFGWGSTSKTNSPSYPKTLQEAKN 178
                      |:..:|.|..|            :.|..:..:.|||.|.  ||...|:.|.....
  Fly   135 ----------AILRLKKPMKGKSLGQLILCKKQLMPGTELRVSGWGLTE--NSEFGPQKLLRTVT 187

  Fly   179 IPIISLDSCAAAL------GSKGQD----VHTTN--LCTGPLTGGTSFCTSDSGGPLVQGNVLIG 231
            :|::....|.|:.      ..|..|    ||.|:  .|.|.| |....||.|||||||..|.:.|
  Fly   188 VPVVDKKKCRASYLPTDWESHKHFDLFLKVHLTDSMFCAGVL-GKKDACTFDSGGPLVYKNQVCG 251

  Fly   232 IVSWGKLPCGQPNSPSVYVQV 252
            |||:| :.|.......||..:
  Fly   252 IVSFG-IGCASKRYYGVYTDI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phae2NP_001285871.1 Tryp_SPc 31..259 CDD:214473 65/250 (26%)
Tryp_SPc 32..262 CDD:238113 64/249 (26%)
CG10587NP_001137989.2 Tryp_SPc 45..278 CDD:214473 65/250 (26%)
Tryp_SPc 46..280 CDD:238113 64/249 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.