DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phae2 and CG11037

DIOPT Version :9

Sequence 1:NP_001285871.1 Gene:Phae2 / 34638 FlyBaseID:FBgn0263235 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_649272.1 Gene:CG11037 / 40317 FlyBaseID:FBgn0037038 Length:292 Species:Drosophila melanogaster


Alignment Length:245 Identity:68/245 - (27%)
Similarity:110/245 - (44%) Gaps:17/245 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LAVCVSQGSGLALDQP-EGRVVGGKAAA-ANSAPYIVSMQYGGTHYCAANIINSNWLVTAAHCLA 75
            |.:.|:|.:.:.|..| |.||:||.... |....|:.::.|.....|...::|.|.::|||||. 
  Fly    42 LTLDVAQLAKIVLPSPHETRVIGGHVTTNAKLGGYLTALLYEDDFVCGGTLLNENIVLTAAHCF- 105

  Fly    76 NRNQVLGSTLVAGSIAVAGTASTTQK---RQITHYVINDLYTGGTVPYDIGLIYTPTAFTWTAAV 137
                 ||....:..|..||.::..||   |.:..:::::.:....:..|:.::...|... ...:
  Fly   106 -----LGRMKASEWIVAAGISNLNQKGIRRHVKDFILSEQFREDDMNMDVAVVLLKTPLK-AKNI 164

  Fly   138 APVKLPSSGVRPTGKADLFGWGSTSKTNSPSYPKTLQEAKNIPIISLDSCAAALGSKGQDVHTTN 202
            ..:.|.|..::|..:..:.|||.|:.....  |..|.....:|||...:|.||.....: :..:.
  Fly   165 GTLSLCSVSLKPGVELVVSGWGMTAPRGRG--PHNLLRTVTVPIIHKKNCRAAYQPTAK-ITDSM 226

  Fly   203 LCTGPLTGGTSFCTSDSGGPLVQGNVLIGIVSWGKLPCGQPNSPSVYVQV 252
            :|...| |....||.|||||||....:.||||:| :.|.....|.||..|
  Fly   227 ICAAVL-GRKDACTFDSGGPLVFKKQVCGIVSFG-IGCASNRYPGVYTDV 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phae2NP_001285871.1 Tryp_SPc 31..259 CDD:214473 62/226 (27%)
Tryp_SPc 32..262 CDD:238113 61/225 (27%)
CG11037NP_649272.1 Tryp_SPc 61..281 CDD:214473 62/226 (27%)
Tryp_SPc 62..283 CDD:238113 61/225 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.