DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phae2 and Jon74E

DIOPT Version :9

Sequence 1:NP_001285871.1 Gene:Phae2 / 34638 FlyBaseID:FBgn0263235 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster


Alignment Length:276 Identity:76/276 - (27%)
Similarity:129/276 - (46%) Gaps:39/276 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LATILLLAVCVSQGSGLA-LDQPE---GRVVGGKAAAANSAPYIVSMQYGGTH----YCAANIIN 63
            ::|||:..:.:.||..:: ||...   ||:.||:.|.||..||.|.:.....:    :|.|::|:
  Fly     3 ISTILVFLLILVQGRSISCLDMGHGIGGRIAGGELARANQFPYQVGLSIEEPNDMYCWCGASLIS 67

  Fly    64 SNWLVTAAHCLANRNQVLGSTLVAGSIAVAGTASTTQKRQITHYVINDLYTGGTVPYDIGLIYTP 128
            ..:|:|||||:  ...|..:..:.|.:.:|............|  ::..:...::..||.|:..|
  Fly    68 DRYLLTAAHCV--EKAVAITYYLGGVLRLAPRQLIRSTNPEVH--LHPDWNCQSLENDIALVRLP 128

  Fly   129 TAFTWTAAVAPVKLPS-SGVRPT---GKADLFGWG-----STSKTNSPSYPKTLQEAKNIPIISL 184
            .......::.|::||. |..|.:   ..|...|||     ||:.:::..|.....|       |.
  Fly   129 EDALLCDSIRPIRLPGLSSSRNSYDYVPAIASGWGRMNDESTAISDNLRYVYRFVE-------SN 186

  Fly   185 DSCAAALGSKGQDVHTTNLCTGPLTGGTSFCTSDSGGPLV------QGNVLIGIVSWGKLPCGQP 243
            :.|..:..    ::..||:|. ..|||.|.||.|||||||      ..::|||:.|:||......
  Fly   187 EDCEYSYA----NIKPTNICM-DTTGGKSTCTGDSGGPLVYSDPVQNADILIGVTSYGKKSGCTK 246

  Fly   244 NSPSVYVQVSSFITWI 259
            ..|||:.::::::.||
  Fly   247 GYPSVFTRITAYLDWI 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phae2NP_001285871.1 Tryp_SPc 31..259 CDD:214473 66/246 (27%)
Tryp_SPc 32..262 CDD:238113 67/247 (27%)
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 66/246 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.