DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phae2 and CG4477

DIOPT Version :9

Sequence 1:NP_001285871.1 Gene:Phae2 / 34638 FlyBaseID:FBgn0263235 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_648295.1 Gene:CG4477 / 39058 FlyBaseID:FBgn0035971 Length:315 Species:Drosophila melanogaster


Alignment Length:236 Identity:66/236 - (27%)
Similarity:103/236 - (43%) Gaps:36/236 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 YIVSMQ-------YGGTHYCAANIINSNWLVTAAHCLANRNQVLGSTLVAGSIAVAGT------- 95
            |.||::       :|..|:|:..|:...:::|:||||.|:.:||.|:.|.  :.||||       
  Fly    53 YCVSLRSRSAEKFFGDNHFCSGVILAPMFVMTSAHCLINKRRVLISSRVL--LIVAGTLNRLKYI 115

  Fly    96 ASTTQKRQITHYVINDLYTGGTVPYDIGLIYTPTAFT-----WTAAVAPVKLPSSGVRPTGKADL 155
            .:.|....:||..:.|.:|... ..|.||:.....|.     .:.|..||..|..|:    |..:
  Fly   116 PNRTFVTPVTHIWLPDSFTMRN-KQDFGLLKVKNPFPRNNEHISIARLPVHPPLPGL----KCKV 175

  Fly   156 FGWGSTSKTNSP--SYPKTLQEAKNIPIISLDSCAAALGSKGQDVHTTNLCTGPLTGGTSFCTSD 218
            .|||...| ..|  ||...:    ::.:|..::||..|.....: |...:.:..||.... |..|
  Fly   176 MGWGRMYK-GGPLASYMLYI----DVQVIDSEACAKWLRVPSVE-HVCAVDSDDLTAQQP-CGGD 233

  Fly   219 SGGPLVQGNVLIGIVSWGKLPCGQPNSPSVYVQVSSFITWI 259
            .|.|::....:.|||:. ...||..:.||:|..|.|...||
  Fly   234 WGAPMLHNGTVYGIVTI-LAGCGVSHLPSLYTNVHSNANWI 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phae2NP_001285871.1 Tryp_SPc 31..259 CDD:214473 64/234 (27%)
Tryp_SPc 32..262 CDD:238113 66/236 (28%)
CG4477NP_648295.1 Tryp_SPc 55..276 CDD:238113 65/234 (28%)
Tryp_SPc 55..273 CDD:214473 63/232 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449499
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.