DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phae2 and CG3650

DIOPT Version :9

Sequence 1:NP_001285871.1 Gene:Phae2 / 34638 FlyBaseID:FBgn0263235 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_611971.1 Gene:CG3650 / 37974 FlyBaseID:FBgn0035070 Length:249 Species:Drosophila melanogaster


Alignment Length:273 Identity:85/273 - (31%)
Similarity:126/273 - (46%) Gaps:32/273 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MWRHRHL--ATILLLAVCVSQGSGLALDQPEGRVVGGKAAAANS-APYIVSMQYGGTHYCAANII 62
            |||...|  .|.|||        |||..|.:.|:|||.....:: ..::|:::|.||.||..:::
  Fly     1 MWRPLFLLQLTQLLL--------GLASGQIQPRIVGGTTTTLSAVGGFVVNLRYDGTFYCGGSLV 57

  Fly    63 NSNWLVTAAHCLANRNQVLGSTLVAGSIAVAGTASTTQK----RQITHYVINDLYTGGTVPYDIG 123
            .|:.:|||||||....        |..|.|.|..|...:    |::..|.|.:.::..::.:|:|
  Fly    58 TSSHVVTAAHCLKGYQ--------ASRITVQGGVSKLSQSGVVRRVARYFIPNGFSSSSLNWDVG 114

  Fly   124 LIYTPTAFTWTAAVAPVKLPSSGVRPTGKADLFGWGSTSKTNSPSYPKTLQEAKNIPIISLDSCA 188
            :|...:|.| .:.:..:.|......|.....:.|||:|...||.  |........|.:|....|.
  Fly   115 VIRLQSALT-GSGITTIPLCQVQWNPGNYMRVSGWGTTRYGNSS--PSNQLRTVRIQLIRKKVCQ 176

  Fly   189 AALGSKGQDVHT-TNLCTGPLTGGTSFCTSDSGGPLVQGNVLIGIVSWGKLPCGQPNSPSVYVQV 252
            .|.  :|:|..| :..|.  .|||...|:.||||.::..|.|.|||||| |.|.....|.||..|
  Fly   177 RAY--QGRDTLTASTFCA--RTGGKDSCSGDSGGGVIFKNQLCGIVSWG-LGCANAQYPGVYTSV 236

  Fly   253 SSFITWIAANQKK 265
            ....::|..:.||
  Fly   237 HRVRSFILRSIKK 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phae2NP_001285871.1 Tryp_SPc 31..259 CDD:214473 70/233 (30%)
Tryp_SPc 32..262 CDD:238113 70/235 (30%)
CG3650NP_611971.1 Tryp_SPc 25..243 CDD:214473 70/233 (30%)
Tryp_SPc 26..243 CDD:238113 69/232 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.