DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phae2 and CG9897

DIOPT Version :9

Sequence 1:NP_001285871.1 Gene:Phae2 / 34638 FlyBaseID:FBgn0263235 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001286753.2 Gene:CG9897 / 37651 FlyBaseID:FBgn0034807 Length:265 Species:Drosophila melanogaster


Alignment Length:288 Identity:72/288 - (25%)
Similarity:113/288 - (39%) Gaps:55/288 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LATILLLAVCVSQGSGLALDQPEGRVVGGKAAAANSAPYIVSMQYGGTHYCAANIINSNWLVTAA 71
            ||.::||.:.......|. ||   |::.|.......||:..|:.......|...||:.|:::|||
  Fly     2 LAPLILLQIVALPWLALG-DQ---RIINGNTVNIKDAPWYASIIVNSKLKCGGAIISKNYILTAA 62

  Fly    72 HCL----ANRNQV-LGSTLVAGSIAVAGTASTTQKRQITHYVINDLYTGGTVPYDIGLIYTPTAF 131
            .|:    |...|| ||::....|.::||         |....::..|:......::.|:.|....
  Fly    63 KCVDGYSARSIQVRLGTSSCGTSGSIAG---------ICKVKVHSQYSSWRFDNNLALLKTCELL 118

  Fly   132 TWTAAVAPV----KLPSSGVRPTGKADLFGWGSTS----------KTNSPSYPKTLQ-----EAK 177
            ..|..:.|:    |:|....|    |::.|.|..|          :.:|....|..|     ...
  Fly   119 NTTDEIKPIERADKVPDDNSR----ANVTGCGGRSGNFLDLILDLRISSGIEEKCFQLPVQLHGT 179

  Fly   178 NIPIISLDSCAAALG------SKGQDVHTTNLCTGPLTGGTSFCTSDSGGPLVQGNVLIGIVSWG 236
            .:.|:|...|||...      .||  :....:||  .:.|...|::|.|.|||..|.|:||:|  
  Fly   180 QVRILSQKQCAADWKVIPFYLLKG--ISDLTICT--KSPGKGACSTDRGSPLVIDNKLVGILS-- 238

  Fly   237 KLPCGQPNSPSVYVQVSSFITWIAANQK 264
              ..|....|.||..:.....|:.:|.|
  Fly   239 --RAGCSIKPDVYANILGHTNWLDSNTK 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phae2NP_001285871.1 Tryp_SPc 31..259 CDD:214473 62/257 (24%)
Tryp_SPc 32..262 CDD:238113 62/259 (24%)
CG9897NP_001286753.2 Tryp_SPc 22..258 CDD:214473 62/256 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.