DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phae2 and Tmprss4

DIOPT Version :9

Sequence 1:NP_001285871.1 Gene:Phae2 / 34638 FlyBaseID:FBgn0263235 Length:265 Species:Drosophila melanogaster
Sequence 2:XP_038937788.1 Gene:Tmprss4 / 367074 RGDID:1305033 Length:478 Species:Rattus norvegicus


Alignment Length:254 Identity:82/254 - (32%)
Similarity:123/254 - (48%) Gaps:27/254 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 CVSQGSGLALDQPEGRVVGGKAAAANSAPYIVSMQYGGTHYCAANIINSNWLVTAAHCLANRNQV 80
            |:..|..|...    |||||..|:|:|.|:.||:||...|.|..:|::.:|::|||||......|
  Rat   234 CLDCGKSLKTT----RVVGGVEASADSWPWQVSIQYNKQHVCGGSILDHHWILTAAHCFRKYLDV 294

  Fly    81 LGSTLVAGSIAVAGTASTTQKRQITHYVINDLYTGGTVPY-----DIGLIYTPTAFTWTAAVAPV 140
            ....:.|||..:..:.|..         :..::.....|.     ||.|:......|::.:|.|:
  Rat   295 SSWKVRAGSNKLGNSPSLP---------VAKIFIAEPNPLQPKEKDIALVKLKMPLTFSGSVRPI 350

  Fly   141 KLPSSG--VRPTGKADLFGWGSTSKTNSPSYPKTLQEAKNIPIISLDSCAAALGSKGQDVHTTNL 203
            .||.|.  :.||....:.|||.|.: |......||.:| ::.:|....|.|....:| :|....|
  Rat   351 CLPFSDEELIPTMPVWVIGWGFTEE-NGGKMSDTLLQA-SVQVIDSARCNAEDAYQG-EVTAGML 412

  Fly   204 CTGPLTGGTSFCTSDSGGPLVQGN---VLIGIVSWGKLPCGQPNSPSVYVQVSSFITWI 259
            |.|...||...|..||||||:...   .::|||||| ..||.|::|.||.:|::::.||
  Rat   413 CAGTPQGGKDTCQGDSGGPLMYHYDKWQVVGIVSWG-YGCGSPSTPGVYTKVTAYLDWI 470

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phae2NP_001285871.1 Tryp_SPc 31..259 CDD:214473 77/237 (32%)
Tryp_SPc 32..262 CDD:238113 78/238 (33%)
Tmprss4XP_038937788.1 LDLa 99..133 CDD:238060
SRCR_2 149..238 CDD:413346 1/3 (33%)
Tryp_SPc 245..470 CDD:214473 77/237 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166341154
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.